Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 0.019
intraductal papillary-mucinous carcinoma... -1.300 0.000
posterior fossa group B ependymoma 1.200 0.000
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
16157265 identification of HEPIS as a protein that binds nsp10 of SARS-CoV

AA Sequence

MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT      1 - 70
HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI     71 - 140
PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK    141 - 210
DTSPDLEKSCD                                                               211 - 221
//

Text Mined References (15)

PMID Year Title
26703212 2016 Search for the Function of NWC, Third Gene Within RAG Locus: Generation and Characterization of NWC-Deficient Mice.
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21478494 2011 Genome-wide association study identifies nidogen 1 (NID1) as a susceptibility locus to cutaneous nevi and melanoma risk.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18433331 2008 Identification of a novel transcriptional repressor (HEPIS) that interacts with nsp-10 of SARS coronavirus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16157265 2005 The interaction of the SARS coronavirus non-structural protein 10 with the cellular oxido-reductase system causes an extensive cytopathic effect.
15971274 2005 Identification of a third evolutionarily conserved gene within the RAG locus and its RAG1-dependent and -independent regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...