Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.19939821862964E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.6881217181928E-4
ovarian cancer 8492 3.17076686808344E-4
astrocytic glioma 2241 0.019454999919

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 0.019
intraductal papillary-mucinous carcinoma... -1.300 0.000
posterior fossa group B ependymoma 1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q86VG3 D3DR18 Q96DD6
Symbols NWC
HEPIS

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)
16157265 identification of HEPIS as a protein that binds nsp10 of SARS-CoV

AA Sequence

MSAHMSGLEIMDEDQLIKDVLDKFLNCHEQTYDEEFLNTFTHLSQEDHVSKRGVFGTDSSENIFTSAKVT      1 - 70
HKNEADDYHLRNKTIFLRTSSQCLEEQVDNFLDLEDLDMDEEIKPQMSEDLLLLPGEVEQDVSTSIPSCI     71 - 140
PFVAQPPTCEVKPKPSVKRMDKQTEEILGDEVQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRK    141 - 210
DTSPDLEKSCD                                                               211 - 221
//

Text Mined References (15)

PMID Year Title
26703212 2016 Search for the Function of NWC, Third Gene Within RAG Locus: Generation and Characterization of NWC-Deficient Mice.
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21478494 2011 Genome-wide association study identifies nidogen 1 (NID1) as a susceptibility locus to cutaneous nevi and melanoma risk.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18433331 2008 Identification of a novel transcriptional repressor (HEPIS) that interacts with nsp-10 of SARS coronavirus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16157265 2005 The interaction of the SARS coronavirus non-structural protein 10 with the cellular oxido-reductase system causes an extensive cytopathic effect.
15971274 2005 Identification of a third evolutionarily conserved gene within the RAG locus and its RAG1-dependent and -independent regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...