Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.67
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
active Crohn's disease 918 0.013384229767275

Synonym

Accession Q86VF5 Q496A6 Q496A7 Q496A8 Q9UDW7
Symbols DC7
MGAT3
DGAT2L2

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
12618427 MGAT3 encodes a approximately 36-kDa transmembrane protein that is highly homologous to MGAT1 and -2 and is expressed in the human gastrointestinal tract with the highest level found in the ileum

AA Sequence

MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTP      1 - 70
NQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPG     71 - 140
LRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQ    141 - 210
KRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGL    211 - 280
LPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI             281 - 341
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12618427 2003 Identification of acyl coenzyme A:monoacylglycerol acyltransferase 3, an intestinal specific enzyme implicated in dietary fat absorption.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.