Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.92
PubTator Score 1.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -1.100 1.4e-04
Amyotrophic lateral sclerosis 1.161 5.9e-03
primary pancreatic ductal adenocarcinoma -1.058 1.9e-02

Gene RIF (2)

AA Sequence

MAGKLRKSHIPGVSIWQLVEEIPEGCSTPDFEQKPVTSALPEGKNAVFRAVVCGEPRPEVRWQNSKGDLS      1 - 70
DSSKYKISSSPGSKEHVLQINKLTGEDTDLYRCTAVNAYGEAACSVRLTVIEVGFRKNRKRHREPQEDLR     71 - 140
KELMDFRKLLKKRAPPAPKKKMDLEQIWQLLMTADRKDYEKICLKYGIVDYRGMLRRLQEMKKEQEDKMA    141 - 210
QYINTISSLRHIRVTKDGNAKFDLELDLKDSQSKIYLYKDGEMIPYGFNNQTKHCLRRLGKRYEFQIQDL    211 - 280
RPEDSGIYQVKVEDAVVFSTELEASAIPPRVVVPLAETHCEEQGDAVFECTLSSPCPSAAWHFRHRLLHP    281 - 350
SDKYEVYVSPDGLTHRLVVRGARFSDMGPYSLGTGLYTSSAWLVVEAGKDKDLQSTSADHKLQSRRSGKD    351 - 420
GRLDIYGERRDATRSSTSRYKPGTGSFSKDAQGPMGHFSQGLADMEVQPGEAATLSCTLTSDLGPGTWFK    421 - 490
DGVKLTTQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTVQDSPTIAPDVTEKLREPLVV    491 - 560
KAGKPVIVKIPFQSHLPIQAAWRKDGAEVVGSSDREAQVDLGDGYTRLCLPSAGRKDCGQYSVTLRSEGG    561 - 630
SVQAELTLQVIDKPDPPQGPMEVQDCHRAGVCLRWRPPRDNGGRTVECYVVERRQAGRSTWLKVGEAPAD    631 - 700
STTFTDAHVEPGRKYTFRVRAVTSEGAGEALESEEILVAPEALPKAPSAPAILSASSQGITLTWTAPRGP    701 - 770
GSAHILGYLIERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD    771 - 840
PMRPPGLVRNLQVTDRSNTSITLSWAGPDTQEGDEAQGYVVELCSSDSLQWLPCHVGTVPVTTYTAKGLR    841 - 910
PGEGYFVRVTAVNEGGQSQPSALDTLVQAMPVTVCPKFLVDSSTKDLLTVKVGDTVRVPVSFEAMPMPEV    911 - 980
TWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVVLRTLQGKEVAHSFRIRVAACPQAPGPIHLQ    981 - 1050
ENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIHTNRFTLLGILPGHEYHFRVVAKNEL   1051 - 1120
GASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTW   1121 - 1190
FKNDRSLEGNPAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST            1191 - 1251
//

Text Mined References (8)

PMID Year Title