Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $119,610
PubMed Score 29.44
PubTator Score 12.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86VE9 B4DMH7 Q495A4 Q495A6
Symbols TPO1
C5orf12

Gene

 Grant Application (2)

Gene RIF (10)

PMID Text
26439863 HIV-1 Nef relocalizes SERINC5 to Rab7-positive endosomal compartments and prevents SERINC5 incorporation into virions
26439863 HIV-1 Nef relocalizes SERINC5 to Rab7-positive endosomal compartments and prevents SERINC5 incorporation into virions
26416734 identification of the host transmembrane protein SERINC5, and to a lesser extent SERINC3, as a potent inhibitor of HIV-1 particle infectivity that is counteracted by Nef
26416734 HIV-1 Nef relocalizes SERINC5 to Rab7-positive endosomal compartments and prevents SERINC5 incorporation into virions
26416733 SERINC3 and SERINC5 together restricted HIV-1 replication, and this restriction was evaded by Nef
26416733 HIV-1 Nef relocalizes SERINC5 to Rab7-positive endosomal compartments and prevents SERINC5 incorporation into virions
26416733 HIV-1 Nef relocalizes SERINC5 to Rab7-positive endosomal compartments and prevents SERINC5 incorporation into virions
23979607 results from a first genome-wide association study of Borderline personality disorder, which shows a promising signal on chromosome 5 corresponding to SERINC5, a protein involved in myelination.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 11 is discussed

AA Sequence

MSAQCCAGQLACCCGSAGCSLCCDCCPRIRQSLSTRFMYALYFILVVVLCCIMMSTTVAHKMKEHIPFFE      1 - 70
DMCKGIKAGDTCEKLVGYSAVYRVCFGMACFFFIFCLLTLKINNSKSCRAHIHNGFWFFKLLLLGAMCSG     71 - 140
AFFIPDQDTFLNAWRYVGAVGGFLFIGIQLLLLVEFAHKWNKNWTAGTASNKLWYASLALVTLIMYSIAT    141 - 210
GGLVLMAVFYTQKDSCMENKILLGVNGGLCLLISLVAISPWVQNRQPHSGLLQSGVISCYVTYLTFSALS    211 - 280
SKPAEVVLDEHGKNVTICVPDFGQDLYRDENLVTILGTSLLIGCILYSCLTSTTRSSSDALQGRYAAPEL    281 - 350
EIARCCFCFSPGGEDTEEQQPGKEGPRVIYDEKKGTVYIYSYFHFVFFLASLYVMMTVTNWFNHVRSAFH    351 - 420
LLP                                                                       421 - 423
//

Text Mined References (12)

PMID Year Title
26416734 2015 HIV-1 Nef promotes infection by excluding SERINC5 from virion incorporation.
26416733 2015 SERINC3 and SERINC5 restrict HIV-1 infectivity and are counteracted by Nef.
23979607 2014 Genome-wide analyses of borderline personality features.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
15637075 2005 Characteristics of the polyamine transporter TPO1 and regulation of its activity and cellular localization by phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...