Property Summary

NCBI Gene PubMed Count 13
PubMed Score 34.04
PubTator Score 12.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (16)

AA Sequence

MSAQCCAGQLACCCGSAGCSLCCDCCPRIRQSLSTRFMYALYFILVVVLCCIMMSTTVAHKMKEHIPFFE      1 - 70
DMCKGIKAGDTCEKLVGYSAVYRVCFGMACFFFIFCLLTLKINNSKSCRAHIHNGFWFFKLLLLGAMCSG     71 - 140
AFFIPDQDTFLNAWRYVGAVGGFLFIGIQLLLLVEFAHKWNKNWTAGTASNKLWYASLALVTLIMYSIAT    141 - 210
GGLVLMAVFYTQKDSCMENKILLGVNGGLCLLISLVAISPWVQNRQPHSGLLQSGVISCYVTYLTFSALS    211 - 280
SKPAEVVLDEHGKNVTICVPDFGQDLYRDENLVTILGTSLLIGCILYSCLTSTTRSSSDALQGRYAAPEL    281 - 350
EIARCCFCFSPGGEDTEEQQPGKEGPRVIYDEKKGTVYIYSYFHFVFFLASLYVMMTVTNWFNHVRSAFH    351 - 420
LLP                                                                       421 - 423
//

Text Mined References (16)

PMID Year Title