Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.41
PubTator Score 3.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q86VD9 Q9H9G6
Symbols SMP3
PIG-Z
GPI-MT-IV

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
11356840 publication also discusses human SMP3

AA Sequence

MQICGSSVASVAAGTSFQVLGPVCWQQLDLKMAVRVLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMA      1 - 70
EDILGVQAARPWEFYPSSSCRSVLFPLLISGSTFWLLRLWEELGPWPGLVSGYALLVGPRLLLTALSFAL     71 - 140
DGAVYHLAPPMGADRWNALALLSGSYVTLVFYTRTFSNTIEGLLFTWLLVLVSSHVTWGPTRKEPAPGPR    141 - 210
WRSWLLGGIVAAGFFNRPTFLAFAVVPLYLWGTRGATNPGLKSLTREALVLLPGAALTAAVFVATDSWYF    211 - 280
SSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHLAVNGFLLFGVLHAQALQAAWQRLQVGLQASAQ    281 - 350
MGLLRALGARSLLSSPRSYLLLLYFMPLALLSAFSHQEARFLIPLLVPLVLLCSPQTQPVPWKGTVVLFN    351 - 420
ALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGAPVEVVDMGGT    421 - 490
EDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSLL    491 - 560
SGAWRDHLSLHIVELGEET                                                       561 - 579
//

Publication (9)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208306 2004 Human Smp3p adds a fourth mannose to yeast and human glycosylphosphatidylinositol precursors in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12655644 2003 Enzymes and auxiliary factors for GPI lipid anchor biosynthesis and post-translational transfer to proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200473 2002 Common origin and evolution of glycosyltransferases using Dol-P-monosaccharides as donor substrate.
11356840 2001 The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols.