Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.41
PubTator Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.85122818069495E-13
ependymoma 2514 1.03451182693901E-8
sonic hedgehog group medulloblastoma 1482 2.9183789970188E-8
pediatric high grade glioma 2712 6.89466333412022E-7
ulcerative colitis 2087 6.88141527588065E-6
pituitary cancer 1972 1.67514777281839E-5
glioblastoma 5572 1.15435898878433E-4
breast carcinoma 1614 1.86884664398663E-4
medulloblastoma, large-cell 6234 3.84229526630077E-4
cutaneous lupus erythematosus 1056 0.00176051166542165
interstitial cystitis 2299 0.00198705618716726
colon cancer 1475 0.00507855811464477
primitive neuroectodermal tumor 3031 0.011549705580083
invasive ductal carcinoma 2950 0.0122623764765785
lung cancer 4473 0.0282809416213202
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0317621028357863
subependymal giant cell astrocytoma 2287 0.0425591600637368
Disease Target Count Z-score Confidence
Intracranial aneurysm 20 3.748 1.9
Alpha 1-antitrypsin deficiency 10 3.265 1.6

Expression

  Differential Expression (17)

Synonym

Accession Q86VD9 Q9H9G6
Symbols SMP3
PIG-Z
GPI-MT-IV

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
11356840 publication also discusses human SMP3

AA Sequence

MQICGSSVASVAAGTSFQVLGPVCWQQLDLKMAVRVLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMA      1 - 70
EDILGVQAARPWEFYPSSSCRSVLFPLLISGSTFWLLRLWEELGPWPGLVSGYALLVGPRLLLTALSFAL     71 - 140
DGAVYHLAPPMGADRWNALALLSGSYVTLVFYTRTFSNTIEGLLFTWLLVLVSSHVTWGPTRKEPAPGPR    141 - 210
WRSWLLGGIVAAGFFNRPTFLAFAVVPLYLWGTRGATNPGLKSLTREALVLLPGAALTAAVFVATDSWYF    211 - 280
SSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHLAVNGFLLFGVLHAQALQAAWQRLQVGLQASAQ    281 - 350
MGLLRALGARSLLSSPRSYLLLLYFMPLALLSAFSHQEARFLIPLLVPLVLLCSPQTQPVPWKGTVVLFN    351 - 420
ALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGAPVEVVDMGGT    421 - 490
EDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSLL    491 - 560
SGAWRDHLSLHIVELGEET                                                       561 - 579
//

Text Mined References (9)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208306 2004 Human Smp3p adds a fourth mannose to yeast and human glycosylphosphatidylinositol precursors in vivo.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12655644 2003 Enzymes and auxiliary factors for GPI lipid anchor biosynthesis and post-translational transfer to proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200473 2002 Common origin and evolution of glycosyltransferases using Dol-P-monosaccharides as donor substrate.
11356840 2001 The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols.