Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.85
PubTator Score 3.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
breast carcinoma -1.200 1.9e-04
colon cancer -3.500 5.1e-03
cutaneous lupus erythematosus -1.200 1.8e-03
ependymoma -1.500 1.0e-08
glioblastoma -1.100 1.2e-06
interstitial cystitis -1.400 2.0e-03
intraductal papillary-mucinous carcinoma... 1.300 3.2e-02
invasive ductal carcinoma -1.100 1.2e-02
lung cancer 1.100 2.8e-02
lung carcinoma 1.100 2.9e-13
medulloblastoma -1.200 1.1e-06
medulloblastoma, large-cell -1.300 3.8e-04
pediatric high grade glioma -1.400 6.9e-07
pituitary cancer 1.300 1.7e-05
primitive neuroectodermal tumor -1.100 1.2e-02
subependymal giant cell astrocytoma -1.281 4.3e-02
ulcerative colitis -2.200 6.9e-06

Gene RIF (1)

AA Sequence

MQICGSSVASVAAGTSFQVLGPVCWQQLDLKMAVRVLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMA      1 - 70
EDILGVQAARPWEFYPSSSCRSVLFPLLISGSTFWLLRLWEELGPWPGLVSGYALLVGPRLLLTALSFAL     71 - 140
DGAVYHLAPPMGADRWNALALLSGSYVTLVFYTRTFSNTIEGLLFTWLLVLVSSHVTWGPTRKEPAPGPR    141 - 210
WRSWLLGGIVAAGFFNRPTFLAFAVVPLYLWGTRGATNPGLKSLTREALVLLPGAALTAAVFVATDSWYF    211 - 280
SSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHLAVNGFLLFGVLHAQALQAAWQRLQVGLQASAQ    281 - 350
MGLLRALGARSLLSSPRSYLLLLYFMPLALLSAFSHQEARFLIPLLVPLVLLCSPQTQPVPWKGTVVLFN    351 - 420
ALGALLFGCLHQGGLVPGLEYLEQVVHAPVLPSTPTHYTLLFTHTYMPPRHLLHLPGLGAPVEVVDMGGT    421 - 490
EDWALCQTLKSFTRQPACQVAGGPWLCRLFVVTPGTTRRAVEKCSFPFKNETLLFPHLTLEDPPALSSLL    491 - 560
SGAWRDHLSLHIVELGEET                                                       561 - 579
//

Text Mined References (9)

PMID Year Title