Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.06
PubTator Score 2.77

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.411 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.200 0.000
non primary Sjogren syndrome sicca 1.100 0.020
lung carcinoma 1.800 0.000

Gene RIF (4)

23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19429682 The main physiological role of SLC25A42 is to import CoA into mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate

AA Sequence

VRGLYKGLSMNWVKGPIAVGISFTTFDLMQILLRHLQS                                    281 - 318

Publication (9)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19429682 2009 A novel member of solute carrier family 25 (SLC25A42) is a transporter of coenzyme A and adenosine 3',5'-diphosphate in human mitochondria.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.