Property Summary

NCBI Gene PubMed Count 179
PubMed Score 701.76
PubTator Score 529.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 3.76060581325265E-11
Duchenne muscular dystrophy 602 2.0370053460738E-9
juvenile dermatomyositis 1189 1.04614110001105E-8
ovarian cancer 8492 1.60982838380941E-8
limb girdle muscular dystrophy 2A 156 4.19840216346467E-7
chronic lymphosyte leukemia 232 3.47919551165813E-6
acute quadriplegic myopathy 1157 4.75396554424485E-6
tuberculosis 1563 4.06331253297974E-5
nasopharyngeal carcinoma 1056 4.490888764409E-5
lung cancer 4473 8.25596982587181E-5
lung adenocarcinoma 2714 8.3164519051354E-5
cutaneous lupus erythematosus 1056 9.67595112936483E-5
primary Sjogren syndrome 789 1.59836329167888E-4
adrenocortical carcinoma 1427 3.00808072429938E-4
head and neck cancer and chronic obstructive pulmonary disease 237 4.21563172263217E-4
glioblastoma 5572 4.2270205809529E-4
posterior fossa group A ependymoma 1511 4.55914064668865E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.54588282518327E-4
non diabetic and post-ischemic heart failure 200 6.08347154615007E-4
medulloblastoma, large-cell 6234 6.24070493703157E-4
interstitial cystitis 2299 6.58654725719187E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00105326289643759
Becker muscular dystrophy 187 0.00114477714895031
astrocytoma 1493 0.00121971624592097
inflammatory breast cancer 404 0.00162964144346975
invasive ductal carcinoma 2950 0.00240235501895143
pituitary cancer 1972 0.00294090601562465
type II diabetes mellitus and post-ischemic heart failure 89 0.00352657853214686
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00619032600367399
ulcerative colitis 2087 0.00839233137021688
group 4 medulloblastoma 1875 0.0104763346000016
pilocytic astrocytoma 3086 0.0114389727906051
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0159654176850608
dermatomyositis 967 0.0191886624912277
colon cancer 1475 0.0256582864843099
Atopic dermatitis 944 0.037500413634184
diabetes mellitus 1663 0.0412834308125792
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q86VB7 C9JIG2 Q07898 Q07899 Q07900 Q07901 Q2VLH7
Symbols M130
MM130
SCARI1

Gene

PANTHER Protein Class (3)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

 GO Function (1)

 CSPA Cell Line (1)

Gene RIF (147)

PMID Text
26616677 we have developed a highly sensitive targeted probe capable of detecting CD163-expressing macrophages that could provide useful information about the state of the atheromatous lesions.
26569178 The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection.
26568320 A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin.
26549495 Increased soluble CD163 blood levels in hepatocellular carcinoma patients correlates with rapid hepatocellular carcinoma progression.
26339412 sCD163 is a sensitive marker protein for liver failure.
26209500 Soluble CD163 is increased in patients with acute pancreatitis.
26135617 therapy with rituximab, cyclophosphamide and fludarabine resulted in a significant reduction in the number of non-classical CD14+CD16++ monocytes and soluble form of CD163 but upregulation of membrane-associated monocyte CD163
26087825 Renal graft CD163+ infiltrates correlated strongly with interstitial inflammation, tubulitis, and peritubular capillaritis.
26045748 CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation.
25944005 could be potentially used as an immune diagnostic marker for malignant pleural effusion
More...

AA Sequence

MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKCSGRVEVKVQE      1 - 70
EWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSN     71 - 140
CTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSG    141 - 210
SSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLE    211 - 280
VRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEW    281 - 350
GKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL    351 - 420
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRLVGGDIPCSGR    421 - 490
VEVKHGDTWGSICDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSLCPVA    491 - 560
PRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKTLGAWGSLCNSHWDIEDAHVLCQQLKCGVAL    561 - 630
STPGGARFGKGNGQIWRHMFHCTGTEQHMGDCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGP    631 - 700
TRPTIPEESAVACIESGQLRLVNGGGRCAGRVEIYHEGSWGTICDDSWDLSDAHVVCRQLGCGEAINATG    701 - 770
SAHFGEGTGPIWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE    771 - 840
VFYNGAWGTVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPDTLWQCPSSPW    841 - 910
EKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFK    911 - 980
EAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCTDISVQKTPQKATTGRSSRQSS    981 - 1050
FIAVGILGVVLLAIFVALFFLTKKRRQRQRLAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSENSHES   1051 - 1120
ADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL                                     1121 - 1156
//

Text Mined References (183)

PMID Year Title
26616677 2015 Targeted gold-coated iron oxide nanoparticles for CD163 detection in atherosclerosis by MRI.
26569178 2015 Soluble CD163 But Not Soluble CD14 Is Associated With Cytomegalovirus Immunoglobulin G Antibody Levels in Virologically Suppressed HIV+ Individuals.
26568320 2015 A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin.
26549495 2016 Macrophage activation marker soluble CD163 may predict disease progression in hepatocellular carcinoma.
26339412 2015 Expression of serum sCD163 in patients with liver diseases and inflammatory disorders.
26209500 2015 Soluble CD163 is increased in patients with acute pancreatitis independent of disease severity.
26135617 2015 Circulating classical CD14++CD16- monocytes predict shorter time to initial treatment in chronic lymphocytic leukemia patients: Differential effects of immune chemotherapy on monocyte-related membrane and soluble forms of CD163.
26087825 2015 Interpreting CD56+ and CD163+ infiltrates in early versus late renal transplant biopsies.
26045748 2015 CD-163 correlated with symptoms (pain or discomfort) of prostatic inflammation.
25944005 2015 CD163+CD14+ macrophages, a potential immune biomarker for malignant pleural effusion.
More...