Property Summary

NCBI Gene PubMed Count 179
Grant Count 66
R01 Count 39
Funding $7,145,925.18
PubMed Score 701.76
PubTator Score 529.11

Knowledge Summary


No data available


  Disease Relevance (50)

Disease Z-score Confidence
Cancer 2,346 4.643 2.3
Histiocytosis 12 4.421 2.2
Human immunodeficiency virus infectious ... 92  3.647 1.8
Synovitis 38 3.248 1.6
Atherosclerosis 275 3.231 1.6
Arthritis 248 3.192 1.6
Cutaneous fibrous histiocytoma 16 3.172 1.6
Liver disease 219 3.066 1.5
Hemophagocytic lymphohistiocytosis 30 3.003 1.5
Atopic dermatitis 944
Becker muscular dystrophy 187
Carcinoma 2,147 1.0
Carotid Artery Diseases 11
Duchenne muscular dystrophy 602
IGA Glomerulonephritis 454
Spontaneous abortion 108
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
astrocytoma 1,493
chronic lymphosyte leukemia 232
colon cancer 1,475
cutaneous lupus erythematosus 1,056
dermatomyositis 933
diabetes mellitus 1,663
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer and chronic obstruc... 237 
inflammatory breast cancer 404
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
tuberculosis 1,557
type II diabetes mellitus and post-ische... 89 
ulcerative colitis 2,087



Accession Q86VB7 C9JIG2 Q07898 Q07899 Q07900 Q07901 Q2VLH7
Symbols M130


PANTHER Protein Class (3)

 GO Function (1)

Gene RIF (147)

26616677 we have developed a highly sensitive targeted probe capable of detecting CD163-expressing macrophages that could provide useful information about the state of the atheromatous lesions.
26569178 The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection.
26568320 A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin.
26549495 Increased soluble CD163 blood levels in hepatocellular carcinoma patients correlates with rapid hepatocellular carcinoma progression.
26339412 sCD163 is a sensitive marker protein for liver failure.
26209500 Soluble CD163 is increased in patients with acute pancreatitis.
26135617 therapy with rituximab, cyclophosphamide and fludarabine resulted in a significant reduction in the number of non-classical CD14+CD16++ monocytes and soluble form of CD163 but upregulation of membrane-associated monocyte CD163
26087825 Renal graft CD163+ infiltrates correlated strongly with interstitial inflammation, tubulitis, and peritubular capillaritis.
26045748 CD-163, related to immune-system (macrophage), correlated with symptoms (pain or discomfort) of prostatic inflammation.
25944005 could be potentially used as an immune diagnostic marker for malignant pleural effusion

AA Sequence

ADFSAAELISVSKFLPISGMEKEAILSHTEKENGNL                                     1121 - 1156

Text Mined References (183)

PMID Year Title
26616677 2015 Targeted gold-coated iron oxide nanoparticles for CD163 detection in atherosclerosis by MRI.
26569178 2015 Soluble CD163 But Not Soluble CD14 Is Associated With Cytomegalovirus Immunoglobulin G Antibody Levels in Virologically Suppressed HIV+ Individuals.
26568320 2015 A subset of CD163+ macrophages displays mixed polarizations in discoid lupus skin.
26549495 2016 Macrophage activation marker soluble CD163 may predict disease progression in hepatocellular carcinoma.
26339412 2015 Expression of serum sCD163 in patients with liver diseases and inflammatory disorders.
26209500 2015 Soluble CD163 is increased in patients with acute pancreatitis independent of disease severity.
26135617 2015 Circulating classical CD14++CD16- monocytes predict shorter time to initial treatment in chronic lymphocytic leukemia patients: Differential effects of immune chemotherapy on monocyte-related membrane and soluble forms of CD163.
26087825 2015 Interpreting CD56+ and CD163+ infiltrates in early versus late renal transplant biopsies.
26045748 2015 CD-163 correlated with symptoms (pain or discomfort) of prostatic inflammation.
25944005 2015 CD163+CD14+ macrophages, a potential immune biomarker for malignant pleural effusion.