Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.23
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASR      1 - 70
TSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIH     71 - 140
IQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA                                      141 - 176
//

Text Mined References (10)

PMID Year Title