Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.23
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASR      1 - 70
TSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIH     71 - 140
IQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA                                      141 - 176
//

Publication (10)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16670083 2006 Magnesium-dependent phosphatase-1 is a protein-fructosamine-6-phosphatase potentially involved in glycation repair.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10889041 2000 MDP-1: A novel eukaryotic magnesium-dependent phosphatase.