Property Summary

Ligand Count 563
NCBI Gene PubMed Count 45
PubMed Score 77.44
PubTator Score 54.03

Knowledge Summary

Patent (10,072)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.51 1.8

Expression

Gene RIF (35)

AA Sequence

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKH      1 - 70
VVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERG     71 - 140
ALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVY    141 - 210
SPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSE    211 - 280
RPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL                            281 - 326
//

Text Mined References (50)

PMID Year Title