Property Summary

NCBI Gene PubMed Count 36
Grant Count 5
Funding $78,788.88
PubMed Score 71.16
PubTator Score 54.03

Knowledge Summary

Patent (10,072)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.385 1.7

Expression

Synonym

Accession Q86V86 A5D8X8 A8K7J0 B1B0P0 Q68BM2
Symbols pim-3

Gene

  TechDev Info (1)

Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
27016481 Pim-3 has a role in human pancreatic cancer cell survival against radiation
26551340 A high percentage of urothelial carcinomas express Pim kinases. Pim expression differs in NILG, NIHG, and IHG lesions.
26238203 MicroRNA506 participates in pancreatic cancer pathogenesis by targeting PIM3
26075720 Pim-3 kinase enhances growth and metastatic properties of prostate cancer xenografts. PC-3 prostate cancer cells overexpressing either Pim-1 or Pim-3 kinases form larger xenograft tumors than the parental PC-3 cells.
25921139 PIM3 expression is higher in ovarian cancer than in normal ovarian tissue. Upregulation of PIM3 promotes proliferation and migration of ovarian cancer cells.
25817345 Knockdown of Pim-3 by specific shRNA slowed decreased proliferation, induced cell cycle arrest in the G0/G1 phase, and increased apoptosis in glioblastoma cells.
25238262 Data demonstrate the role of PIM kinases in driving myeloid leukemia, and as candidate molecules for therapy against human malignancies.
24799066 Blocking the activities of PIM kinases(PIM1, PIM2 and PIM3) could prevent pancreatic cancer development. PIM kinases(PIM1, PIM2 and PIM3) may be a novel target for cancer therapy
24789328 cancer development and in promoting tumor neovascularization and subsequent tumor growth. Targeting Pim-3 may play a dual role in halting tumor progression, by promoting tumor cell death and blocking angiogenesis
24723452 we constructed a dual-function small hairpin RNA (shRNA) vector containing an shRNA targeting Pim-3 and a TLR7-stimulating ssRNA.
More...

AA Sequence

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKH      1 - 70
VVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERG     71 - 140
ALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVY    141 - 210
SPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSE    211 - 280
RPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL                            281 - 326
//

Text Mined References (41)

PMID Year Title
27016481 2016 Pim-3 contributes to radioresistance through regulation of the cell cycle and DNA damage repair in pancreatic cancer cells.
26551340 Patterns and Significance of PIM Kinases in Urothelial Carcinoma.
26238203 2015 MicroRNA?506 participates in pancreatic cancer pathogenesis by targeting PIM3.
26075720 2015 Pim Kinases Promote Migration and Metastatic Growth of Prostate Cancer Xenografts.
25921139 2015 Aberrant expression of pim-3 promotes proliferation and migration of ovarian cancer cells.
25817345 2015 Knockdown of Pim-3 suppresses the tumorigenicity of glioblastoma by regulating cell cycle and apoptosis.
25238262 2014 The PIM family of oncoproteins: small kinases with huge implications in myeloid leukemogenesis and as therapeutic targets.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24799066 2014 PIM kinases: an overview in tumors and recent advances in pancreatic cancer.
24789328 2014 Pim-3 promotes human pancreatic cancer growth by regulating tumor vasculogenesis.
More...