Property Summary

NCBI Gene PubMed Count 10
PubMed Score 313.60
PubTator Score 8.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (2)

AA Sequence

MGGLRLLAVALTCCWWPQGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAK      1 - 70
LYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQ     71 - 140
VEDIPFEMVLLNPDAEGNPFDHFSAGESGLHEFFFLLVLVYFVIACIYAQSLWQAIKKGGPMHMILKVLT    141 - 210
TALLLQAGSALANYIHFSSYSKDGIGVPFMGSLAEFFDIASQIQMLYLLLSLCMGWTIVRMKKSQSRPLQ    211 - 280
WDSTPASTGIAVFIVMTQSVLLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLGCGLYQIITVERS    281 - 350
TLKREFYITFAKGCILWFLCHPVLACISVIFSDYQRDKVITIGVILCQSVSMVILYRLFLSHSLYWEVSS    351 - 420
LSSVTLPLTISSGHKSRPHF                                                      421 - 440
//

Text Mined References (11)

PMID Year Title