Property Summary

NCBI Gene PubMed Count 10
Grant Count 54
R01 Count 23
Funding $12,235,247.58
PubMed Score 288.41
PubTator Score 8.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25772937 A null GPR180 mutation segregates over two generations with iridocorneal angle dysgenesis, consistent with the view that deletions of this gene are the cause of MCOR.
12730718 22 SNPs were isolated from the ITR locus by systematically screening genomic DNA from 48 healthy Japanese individuals

AA Sequence

MGGLRLLAVALTCCWWPQGSQGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAK      1 - 70
LYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQTWHVFYADKYTCQDDKENSQ     71 - 140
VEDIPFEMVLLNPDAEGNPFDHFSAGESGLHEFFFLLVLVYFVIACIYAQSLWQAIKKGGPMHMILKVLT    141 - 210
TALLLQAGSALANYIHFSSYSKDGIGVPFMGSLAEFFDIASQIQMLYLLLSLCMGWTIVRMKKSQSRPLQ    211 - 280
WDSTPASTGIAVFIVMTQSVLLLWEQFEDISHHSYHSHHNLAGILLIVLRICLALSLGCGLYQIITVERS    281 - 350
TLKREFYITFAKGCILWFLCHPVLACISVIFSDYQRDKVITIGVILCQSVSMVILYRLFLSHSLYWEVSS    351 - 420
LSSVTLPLTISSGHKSRPHF                                                      421 - 440
//

Publication (11)

PMID Year Title
25772937 2015 Submicroscopic deletions at 13q32.1 cause congenital microcoria.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12730718 2003 High-density SNP map of human ITR, a gene associated with vascular remodeling.
12538434 2003 Inhibition of experimental intimal thickening in mice lacking a novel G-protein-coupled receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...