Property Summary

NCBI Gene PubMed Count 54
PubMed Score 263.23
PubTator Score 55.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
HIV Infections 100
Disease Target Count P-value
non-small cell lung cancer 2798 2.83979849609807E-20
Breast cancer 3099 1.16761462624554E-9
ovarian cancer 8492 7.04154747144032E-6
medulloblastoma, large-cell 6234 6.42208691884744E-5
osteosarcoma 7933 6.89216623429124E-4
pancreatic cancer 2300 7.54143922362863E-4
invasive ductal carcinoma 2950 0.00124751385727603
Atopic dermatitis 944 0.00135405770943741
glioblastoma 5572 0.00146342453621415
nasopharyngeal carcinoma 1056 0.0020451985537026
primary pancreatic ductal adenocarcinoma 1271 0.00323928549921078
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00414962086212489
group 3 medulloblastoma 2254 0.00447056944935898
posterior fossa group B ependymoma 1530 0.00565290137377414
pediatric high grade glioma 2712 0.0106798263213449
Disease Target Count Z-score Confidence
West Nile encephalitis 8 3.494 1.7

Expression

Synonym

Accession Q86V81 O43672 Tho4
Symbols ALY
BEF
REF
THOC4
ALY/REF

Gene

PDB

3ULH  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (21)

PMID Text
26773052 A short conserved motif in ALYREF directs cap- and exon junction complex-dependent assembly of export complexes on spliced mRNAs.
24753416 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
24550725 the data provides the first site-specific description of how viral mRNA is locked by a herpes viral adaptor protein in complex with cellular ALYREF, giving herpesvirus access to the cellular mRNA export machinery
23826332 a spatial map is produced in living cells of the sites for the interaction of two TREX subunits, Alyref and Chtop, with Nxf1.
23637401 The interaction of the cellular export adaptor protein Aly/REF with ICP27 contributes to the efficiency of herpes simplex virus 1 mRNA export.
23297349 ALY is a novel E2F2-interacting protein and a relevant modulator of E2F-responsive gene expression.
23242234 High ALY expression is associated with lymph node metastasis in oral squamous cell carcinoma.
23222130 Authors propose that Aly, THO and UAP56 form a highly integrated unit to associate with the spliced mRNA and function in mRNA export.
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
22761374 REF/Aly-ORF57 interaction is not essential for KSHV lytic replication but may contribute to target RNA stability independent of effects on RNA export, suggesting a novel role for REF/Aly in viral RNA metabolism.
More...

AA Sequence

MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGG      1 - 70
RNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYD     71 - 140
RSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFG    141 - 210
GGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS                           211 - 257
//

Text Mined References (73)

PMID Year Title
26773052 2016 A short conserved motif in ALYREF directs cap- and EJC-dependent assembly of export complexes on spliced mRNAs.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
24550725 2014 Competitive and cooperative interactions mediate RNA transfer from herpesvirus saimiri ORF57 to the mammalian export adaptor ALYREF.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23826332 2013 Mapping interactions between mRNA export factors in living cells.
23637401 2013 The interaction of the cellular export adaptor protein Aly/REF with ICP27 contributes to the efficiency of herpes simplex virus 1 mRNA export.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
More...