Property Summary

NCBI Gene PubMed Count 58
PubMed Score 282.54
PubTator Score 55.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis 2.300 1.4e-03
Breast cancer 1.200 3.4e-05
glioblastoma 1.300 1.5e-03
group 3 medulloblastoma 2.300 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 4.1e-03
invasive ductal carcinoma 1.700 1.2e-03
medulloblastoma, large-cell 1.200 6.4e-05
nasopharyngeal carcinoma 1.200 2.0e-03
non-small cell lung cancer 1.419 2.8e-20
osteosarcoma 2.862 6.9e-04
ovarian cancer 1.200 4.2e-03
pancreatic cancer 1.100 7.5e-04
pediatric high grade glioma 1.100 1.1e-02
posterior fossa group B ependymoma 1.100 5.7e-03
primary pancreatic ductal adenocarcinoma 1.349 3.2e-03

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (25)

AA Sequence

MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGG      1 - 70
RNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYD     71 - 140
RSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFG    141 - 210
GGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS                           211 - 257
//

Text Mined References (77)

PMID Year Title