Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.10
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma -1.018 2.5e-03
group 3 medulloblastoma 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... -1.200 8.9e-04
osteosarcoma -2.269 3.6e-05

Gene RIF (1)

AA Sequence

MGPLTFTDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEKEKEPCKMKRHEM      1 - 70
VDEPPVVCSHFAEDFWPEQDIKDSFQKVTLRRYDKRGHENLQLRKGYKTVGDCKLYKGGYNGLNQCLTLT     71 - 140
QSKMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGKSFCMLSQLTQHKKIHIRENTYRCKEFGNAF    141 - 210
NQSSALTNHKRIYVGEKHYRCEECGKAFNHYSTLTNHKRIHTGEKPYKCKECGKAFSRYSTLTTHKRIHS    211 - 280
GEKPYKCDECGKTFSISSTFTKHKIIHTEEKPYKCKECGKAFNRSSTLTSHKRIHTGEKPYKCEECGKAF    281 - 350
NWSSTLTKHKVIHTGEKPYKCEECGKAFNQSSRLTRHKKIHTGEEPYKFEKCGRVFTCSSTLTQDKKIHT    351 - 420
GEKPYNCEECGKVFTYSSTLTRHKRIHTEEKPYKCNECGKAFNRSSHLTSHRRIHTGEKPYKCEECGKAF    421 - 490
KQSSNLNSHKKIHSGEKPYKCEECGKAFILSSRLTQHKKIHTGEKPYKCEECGKAFNRSSRLTQHKKIHT    491 - 560
GEKPYKCKQCDKAFTHSSNLSSHKKIHSGEKPYKCEECGKAFNRSSRLTQHKKIHTREKPYKCEECAKAF    561 - 630
TRSSRLTQHKKIHRMGVVAHACNPSTLGGRGGRITRSGDRDRPG                              631 - 674
//

Text Mined References (6)

PMID Year Title