Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.08
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 5.61119552637737E-12
ovarian cancer 8492 2.84730559902001E-7
pilocytic astrocytoma 3086 4.86632657133739E-6
atypical teratoid / rhabdoid tumor 4369 5.80539701441859E-6
pituitary cancer 1972 7.28004618352728E-6
osteosarcoma 7933 4.45787970091994E-5
medulloblastoma 1524 1.0619113498044E-4
gastric cancer 436 3.06713893674427E-4
glioblastoma 5572 4.50508388653147E-4
adult high grade glioma 2148 5.36969044550432E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00257666292308945
primitive neuroectodermal tumor 3031 0.00356344901398206
pancreatic cancer 2300 0.00479339563265229
pancreatic carcinoma 567 0.00479339563265229
medulloblastoma, large-cell 6234 0.0114490877419999
head and neck cancer and chronic obstructive pulmonary disease 237 0.0157079476404554
lung cancer 4473 0.0173672761425515
acute myeloid leukemia 785 0.0216338123196836
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.035572991424282

Expression

  Differential Expression (19)

Synonym

Accession Q86V48 Q5TH93 Q8N4X3 Q8TEH1
Symbols LUZP

Gene

  Ortholog (8)

Pathway (1)

AA Sequence

MAEFTSYKETASSRHLRFKLQSLSRRLDELEEATKNLQKAEDELLDLQDKVIQAEGSNSSMLAEIEVLRQ      1 - 70
RVLRIEGKDEEIKRAEDLCRLMKEKLEEEENLTRELKSEIERLQKRMAELEKLEEAFSRSKNDCTQLCLS     71 - 140
LNEERNLTKKISSELEMLRVKVKELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKL    141 - 210
IKELTQKLEQNKKMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSENEKN    211 - 280
RNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQLEEIKLQIKKQ    281 - 350
KELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKRERLRNREFALNNENYSLSNRQ    351 - 420
VSSPSFTNRRAAKASHMGVSTDSGTQETKKTEDRFVPGSSQSEGKKSREQPSVLSRYPPAAQEHSKAWKG    421 - 490
TSKPGTESGLKGKVEKTTRTFSDTTHGSVPSDPLGRADKASDTSSETVFGKRGHVLGNGSQVTQAANSGC    491 - 560
SKAIGALASSRRSSSEGLSKGKKAANGLEADNSCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQP    561 - 630
AAVVMEDSSPHEALRCRVIKSSGREKPDSDDDLDIASLVTAKLVNTTITPEPEPKPQPNSREKAKTRGAP    631 - 700
RTSLFENDKDAGMENESVKSVRASTNTMELPDTNGAGVKSQRPFSPREALRSRAIIKPVIVDKDVKKIMG    701 - 770
GSGTETTLEKQKPVSKPGPNKVTSSITIYPSDSSSPRAAPGEALRERHTSTSNIQVGLAELTSVSNHVSS    771 - 840
PFELSIHKHDITLQLAEAERMADGPLKDRPETVVSRSSIIIKPSDPVERNSHAPPAETIRWKSHSAPSEV    841 - 910
GFSDARHVTVRNAWKSRRDLKSLEDPPTRIGKNVESTNSNAYTQRSSTDFSELEQPRSCLFEQGTRRVGP    911 - 980
SSGDAPEPSSRRTQSSLTVSEVLTRRNRVGDTITVAAWNHSASMEEEGEDCTLSVYRQLHNSLDPSELPG    981 - 1050
KQGLPESGRVRAEERLRPTRPCAEEN                                               1051 - 1076
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...