Property Summary

NCBI Gene PubMed Count 3
Grant Count 5
R01 Count 5
Funding $559,806.8
PubMed Score 2.79
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.852 0.000
medulloblastoma -1.100 0.000
primitive neuroectodermal tumor -1.400 0.002
intraductal papillary-mucinous carcinoma... 1.300 0.017
sarcoidosis -1.300 0.000
ulcerative colitis -1.400 0.000

Synonym

Accession Q86V40 B4DKK8 I6UMB9
Symbols TIKI1
C2orf89

Gene

Gene RIF (1)

PMID Text
22726442 Tiki1 antagonizes Wnt function in embryos and human cells via a TIKI homology domain that is conserved from bacteria to mammals and acts likely as a protease to cleave eight amino-terminal residues of a Wnt protein, resulting in oxidized Wnt oligomers that exhibit normal secretion but minimized receptor-binding capability.

AA Sequence

MSPWSWFLLQTLCLLPTGAASRRGAPGTANCELKPQQSELNSFLWTIKRDPPSYFFGTIHVPYTRVWDFI      1 - 70
PDNSKEAFLQSSIVYFELDLTDPYTISALTSCQMLPQGENLQDVLPRDIYCRLKRHLEYVKLMMPLWMTP     71 - 140
DQRGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTEVDIKSRGVPVLDLFLAQEAERLRKQTGAVEKVE    141 - 210
EQCHPLNGLNFSQVIFALNQTLLQQESLRAGSLQIPYTTEDLIKHYNCGDLSSVILSHDSSQVPNFINAT    211 - 280
LPPQERITAQEIDSYLRRELIYKRNERIGKRVKALLEEFPDKGFFFAFGAGHFMGNNTVLDVLRREGYEV    281 - 350
EHAPAGRPIHKGKSKKTSTRPTLSTIFAPKVPTLEVPAPEAVSSGHSTLPPLVSRPGSADTPSEAEQRFR    351 - 420
KKRRRSQRRPRLRQFSDLWVRLEESDIVPQLQVPVLDRHISTELRLPRRGHSHHSQMVASSACLSLWTPV    421 - 490
FWVLVLAFQTETPLL                                                           491 - 505
//

Text Mined References (6)

PMID Year Title
25354456 2014 Expression and evolution of the Tiki1 and Tiki2 genes in vertebrates.
22726442 2012 Tiki1 is required for head formation via Wnt cleavage-oxidation and inactivation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.