Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.81
PubTator Score 3.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.300 1.7e-02
medulloblastoma -1.100 3.5e-04
osteosarcoma -1.852 1.4e-06
primitive neuroectodermal tumor -1.400 1.5e-03
sarcoidosis -1.300 5.0e-05
ulcerative colitis -1.400 3.9e-05

Gene RIF (1)

AA Sequence

MSPWSWFLLQTLCLLPTGAASRRGAPGTANCELKPQQSELNSFLWTIKRDPPSYFFGTIHVPYTRVWDFI      1 - 70
PDNSKEAFLQSSIVYFELDLTDPYTISALTSCQMLPQGENLQDVLPRDIYCRLKRHLEYVKLMMPLWMTP     71 - 140
DQRGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTEVDIKSRGVPVLDLFLAQEAERLRKQTGAVEKVE    141 - 210
EQCHPLNGLNFSQVIFALNQTLLQQESLRAGSLQIPYTTEDLIKHYNCGDLSSVILSHDSSQVPNFINAT    211 - 280
LPPQERITAQEIDSYLRRELIYKRNERIGKRVKALLEEFPDKGFFFAFGAGHFMGNNTVLDVLRREGYEV    281 - 350
EHAPAGRPIHKGKSKKTSTRPTLSTIFAPKVPTLEVPAPEAVSSGHSTLPPLVSRPGSADTPSEAEQRFR    351 - 420
KKRRRSQRRPRLRQFSDLWVRLEESDIVPQLQVPVLDRHISTELRLPRRGHSHHSQMVASSACLSLWTPV    421 - 490
FWVLVLAFQTETPLL                                                           491 - 505
//

Text Mined References (6)

PMID Year Title