Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.32
PubTator Score 10.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (10)

PMID Text
26177649 to the best of our knowledge, these results are the first clinical data indicating that nuclear VASH2, but not cytoplasmic VASH2, promotes cell proliferation by driving the cell cycle from the G0/G1 to S phase.
25916042 Suggest that overexpression of VASH2 in pancreatic ductal adenocarcinoma accelerated the pace of tumor development toward a more serious malignant phenotype and was associated with a poor clinical outcome.
25269476 MiR200-upregulated Vasohibin 2 promotes the malignant transformation of tumors by inducing epithelial-mesenchymal transition in hepatocellular carcinoma
25184477 VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization.
24595063 VASH2 overexpression downregulated wild-type p53.
23615928 This is the first study to report differences in the intracellular localization of the VASH2 protein and, hence, a new research direction on the study of VASH2
23100270 Data suggest that VASH1 is expressed in vascular endothelium to terminate angiogenesis; VASH2 appears to be expressed in other cells (primarily mononuclear leukocytes) to promote angiogenesis. [REVIEW]
22826464 VASH2 expressed in serous ovarian carcinoma cells promoted tumor growth and peritoneal dissemination by promoting angiogenesis.
22614011 VASH2 contributes to the angiogenesis in hepatocellular carcinoma via an Small vasohibin binding protein-mediated paracrine mechanism.
22438034 vasohibin-1 and vasohibin-2 mRNA are expressed in gastric cancer cells and in tumor-associated macrophages (TAMs), and their expressions are altered by hypoxia.

AA Sequence

MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHV      1 - 70
AKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLS     71 - 140
GLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMS    141 - 210
RRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIR    211 - 280
KELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVG    281 - 350
YQIRI                                                                     351 - 355
//

Text Mined References (19)

PMID Year Title
26177649 2015 Nuclear vasohibin-2 promotes cell proliferation by inducing G0/G1 to S phase progression.
25916042 Expression of vasohibin-2 in pancreatic ductal adenocarcinoma promotes tumor progression and is associated with a poor clinical outcome.
25269476 2014 MiR200-upregulated Vasohibin 2 promotes the malignant transformation of tumors by inducing epithelial-mesenchymal transition in hepatocellular carcinoma.
25184477 2014 Role of the vasohibin family in the regulation of fetoplacental vascularization and syncytiotrophoblast formation.
24595063 2014 Vasohibin 2 decreases the cisplatin sensitivity of hepatocarcinoma cell line by downregulating p53.
23615928 2013 Generation and characterization of rabbit polyclonal antibodies against Vasohibin-2 for determination of its intracellular localization.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23100270 2013 The vasohibin family: a novel family for angiogenesis regulation.
22826464 2012 Vasohibin-2 expressed in human serous ovarian adenocarcinoma accelerates tumor growth by promoting angiogenesis.
22614011 2013 Vasohibin 2 is transcriptionally activated and promotes angiogenesis in hepatocellular carcinoma.
More...