Property Summary

NCBI Gene PubMed Count 127
Grant Count 48
R01 Count 31
Funding $2,135,556.15
PubMed Score 115.02
PubTator Score 130.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
spina bifida -1.149 0.040
ductal carcinoma in situ -1.300 0.004
ovarian cancer 1.600 0.000
Down syndrome 1.100 0.001

Gene RIF (132)

PMID Text
26631404 PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls
26459399 Endometriotic stromal cell proliferation is linked to increased expression of AdipoR2 (and AdipoR1) gene receptor expression.
26219823 Results identified miR-375 and its direct target, ADIPOR2 as androgen regulated molecules suggesting an important role in the mechanism of the increase in visceral fat mass and the associated insulin resistance caused by testosterone deficiency.
26146630 In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin
26111083 Two ADIPOR2 SNPs (rs11061925 and rs929434) were associated with fasting plasma triglyceride concentrations in the entire sample of HIV-infected patients.
25892445 Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2.
25863129 These results strengthen the evidence for the role of AdipoR2 in prostate cancer progression.
25855295 crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively
25640382 This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors.
25575462 Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2.
More...

AA Sequence

MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQ      1 - 70
EDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIF     71 - 140
RIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEG    141 - 210
VSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAG    211 - 280
VFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL    281 - 350
FHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL                                      351 - 386
//

Text Mined References (128)

PMID Year Title
26631404 2016 Downregulation of adiponectin system in granulosa cells and low levels of HMW adiponectin in PCOS.
26459399 2016 in vitro Anti-Proliferative Effect of Adiponectin on Human Endometriotic Stromal Cells through AdipoR1 and AdipoR2 Gene Receptor Expression.
26219823 2015 Inhibition of adipogenic differentiation of human SGBS preadipocytes by androgen-regulated microRNA miR-375.
26146630 2015 Expression of Adiponectin Receptors on Peripheral Blood Leukocytes of Hypertensive Children Is Associated with the Severity of Hypertension.
26111083 2015 Polymorphisms in adiponectin receptor genes are associated with lipodystrophy-related phenotypes in HIV-infected patients receiving antiretroviral therapy.
25892445 2015 Characterisation of the adiponectin receptors: Differential cell-surface expression and temporal signalling profiles of AdipoR1 and AdipoR2 are regulated by the non-conserved N-terminal trunks.
25863129 2015 Tumor expression of adiponectin receptor 2 and lethal prostate cancer.
25855295 2015 Crystal structures of the human adiponectin receptors.
25640382 2015 Adipo-R1 and adipo-R2 expression in colorectal adenomas and carcinomas.
25575462 2015 Expression, purification, crystallization, and preliminary X-ray crystallographic studies of the human adiponectin receptors, AdipoR1 and AdipoR2.
More...