Property Summary

NCBI Gene PubMed Count 136
PubMed Score 128.82
PubTator Score 130.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Infertility, Female 28 0.0 0.0
Disease Target Count
Female infertility 30
Disease Target Count P-value
malignant mesothelioma 3232 1.3e-06
ovarian cancer 8520 3.8e-06
Down syndrome 499 7.4e-04
ductal carcinoma in situ 1745 4.1e-03
spina bifida 1074 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Dermatitis 157 0.0 1.2

Expression

  Differential Expression (5)

Disease log2 FC p
Down syndrome 1.100 7.4e-04
ductal carcinoma in situ -1.300 4.1e-03
malignant mesothelioma 1.200 1.3e-06
ovarian cancer 1.600 3.8e-06
spina bifida -1.149 4.0e-02

Protein-protein Interaction (2)

Gene RIF (141)

AA Sequence

MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQ      1 - 70
EDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIF     71 - 140
RIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEG    141 - 210
VSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAG    211 - 280
VFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQL    281 - 350
FHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL                                      351 - 386
//

Text Mined References (138)

PMID Year Title