Property Summary

NCBI Gene PubMed Count 10
PubMed Score 127.09
PubTator Score 14.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.271 3.1e-03
adult high grade glioma -1.100 1.5e-02
astrocytic glioma -1.100 2.3e-03
atypical teratoid / rhabdoid tumor -1.100 1.6e-03
ependymoma -1.500 3.7e-03
glioblastoma -1.300 1.0e-03
intraductal papillary-mucinous adenoma (... 1.400 1.3e-03
intraductal papillary-mucinous carcinoma... 1.500 7.1e-04
intraductal papillary-mucinous neoplasm ... 1.700 3.4e-03
lung carcinoma 1.100 2.5e-24
medulloblastoma -1.100 1.2e-02
non-small cell lung cancer 1.105 4.4e-16
oligodendroglioma -1.200 5.5e-18

Gene RIF (2)

AA Sequence

MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSDFWAEFWKFSG      1 - 70
IVFSRVYDEVVDTSKGIADVPEWFKGSRLNYAENLLRHKENDRVALYIAREGKEEIVKVTFEELRQEVAL     71 - 140
FAAAMRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAV    141 - 210
VYNGKEHNHMEKLQQVVKGLPDLKKVVVIPYVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLP    211 - 280
FSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAA    281 - 350
MVLYDGSPLVPTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHSLQMLHTILSTGSPLKAQSYE    351 - 420
YVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWGESGELVCTKP    421 - 490
IPCQPTHFWNDENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIVMLGRSDGTLNPNGVRFGSSEIYNIV    491 - 560
ESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLVKRIRDAIRMGLSARHVPSLILETKGIPYTL    561 - 630
NGKKVEVAVKQIIAGKAVEQGGAFSNPETLDLYRDIPELQGF                                631 - 672
//

Text Mined References (13)

PMID Year Title