Property Summary

NCBI Gene PubMed Count 10
PubMed Score 114.40
PubTator Score 14.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 3.20098123753719E-26
lung carcinoma 2844 2.46438934342354E-24
oligodendroglioma 2849 5.51931329462501E-18
non-small cell lung cancer 2798 4.35574587588857E-16
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.09175186095489E-4
glioblastoma 5572 0.00100381976122585
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00134123684428645
atypical teratoid / rhabdoid tumor 4369 0.00162153138027989
adrenocortical carcinoma 1427 0.00305383602006547
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00338799396635461
ependymoma 2514 0.00367957274402977
adult high grade glioma 2148 0.0145366463540686
sonic hedgehog group medulloblastoma 1482 0.0148722169371625

Expression

Synonym

Accession Q86V21 Q49AB9 Q49AC3 Q658Q8 Q8IWD2 Q8NEW5 Q9BSJ9 Q9H829 Q9HA19
Symbols ACSF1
SUR-5

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Gene RIF (2)

PMID Text
20102333 the human AACS promoter is a PPARgamma target gene and this nuclear receptor is recruited to the AACS promoter by direct interaction with Sp1
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSDFWAEFWKFSG      1 - 70
IVFSRVYDEVVDTSKGIADVPEWFKGSRLNYAENLLRHKENDRVALYIAREGKEEIVKVTFEELRQEVAL     71 - 140
FAAAMRKMGVKKGDRVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAV    141 - 210
VYNGKEHNHMEKLQQVVKGLPDLKKVVVIPYVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLP    211 - 280
FSHPLFIMFSSGTTGAPKCMVHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAA    281 - 350
MVLYDGSPLVPTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHSLQMLHTILSTGSPLKAQSYE    351 - 420
YVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWGESGELVCTKP    421 - 490
IPCQPTHFWNDENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIVMLGRSDGTLNPNGVRFGSSEIYNIV    491 - 560
ESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLVKRIRDAIRMGLSARHVPSLILETKGIPYTL    561 - 630
NGKKVEVAVKQIIAGKAVEQGGAFSNPETLDLYRDIPELQGF                                631 - 672
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20102333 2010 Transcriptional regulation of the human acetoacetyl-CoA synthetase gene by PPARgamma.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17762044 2007 Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12623130 2003 Expression of acetoacetyl-CoA synthetase, a novel cytosolic ketone body-utilizing enzyme, in human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...