Property Summary

NCBI Gene PubMed Count 24
PubMed Score 93.75
PubTator Score 22.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung adenocarcinoma 2714 5.06578939410668E-10
osteosarcoma 7933 4.09024034249632E-6
interstitial cystitis 2299 8.35705823339383E-5
ovarian cancer 8492 1.91825356941184E-4
psoriasis 6685 2.36162731249157E-4
ductal carcinoma in situ 1745 4.34049315143922E-4
medulloblastoma, large-cell 6234 5.38629848973183E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.28150338867321E-4
ependymoma 2514 9.48773831877939E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.8855395656284E-4
pilocytic astrocytoma 3086 0.00175091618346913
invasive ductal carcinoma 2950 0.00425769882794659
group 3 medulloblastoma 2254 0.00684443451343681
pituitary cancer 1972 0.00958960493983621
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0195205965297103
Endometriosis 535 0.0260733834672006
spina bifida 1064 0.0338840927787601
gastric carcinoma 832 0.0363743801805289
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Disease Target Count Z-score Confidence
Chromosome 1p36 deletion syndrome 24 4.09 2.0

Expression

  Differential Expression (18)

Synonym

Accession Q86V15 Q078S9 Q2EN02 Q5T9S1 Q6ZNM8 Q8WX49 Q8WX50 Q9BT16 Q9NXC6
Symbols CST
SRG
CAS11
ZNF693
dJ734G22.1

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (11)

PMID Text
26296975 CASZ1b binds to chromatin and recruits NuRD complexes to orchestrate epigenetic-mediated transcriptional programs
23892435 CASZ1 inhibits cell cycle progression in neuroblastoma by restoring retinoblastoma protein activity.
22331471 This study identifies key domains needed for CASZ1b to regulate gene transcription; a link between loss of CASZ1b transcriptional activity and attenuation of CASZ1b-mediated inhibition of neuroblastoma growth and tumorigenicity
22262398 Papillomavirus DNA integration is associated with loss of CASZ1 gene and thus cervical carcinogenesis.
22068036 determined that the tumor suppressors CLU, NGFR, and RUNX3 were also directly repressed by EZH2 like CASZ1 in NB cells
21490919 The study indicates that although their mechanisms of regulation may be distinct, both CASZ1b and CASZ1a have largely redundant but critical roles in suppressing tumor cell growth.
21252912 CASZ1 is a critical modulator of neural cell development, and that somatically acquired disruption of normal CASZ1 expression contributes to the malignant phenotype of human Neuroblastoma.
20479155 Observational study of gene-disease association. (HuGE Navigator)
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
17727731 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQPRDQERSGPE      1 - 70
SGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEGVYMVQPQGCSDEEDHAEEPS     71 - 140
KDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAASTMTEFLGMFGYDDQNTRDELARKISFEKLH    141 - 210
AGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPS    211 - 280
STAHLETKATILPLPSHSSVQMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLF    281 - 350
KPGEGSPDMGGAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL    351 - 420
SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHIHCAYQYREHY    421 - 490
HCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNK    491 - 560
VYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKH    561 - 630
KSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSS    631 - 700
GALGLPPSLLGAKDTEHEESSNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNS    701 - 770
KISGLLPQGLPGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV    771 - 840
ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVK    841 - 910
PEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEG    911 - 980
SPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIK    981 - 1050
HANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWK   1051 - 1120
QLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCK   1121 - 1190
YVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP   1191 - 1260
WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLG   1261 - 1330
KNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAK   1331 - 1400
KRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCG   1401 - 1470
RTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQ   1471 - 1540
DVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAP   1541 - 1610
GPPISLDGSLSLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE   1611 - 1680
ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPALAALAALGAPG   1681 - 1750
PAPTAASSP                                                                1751 - 1759
//

Text Mined References (26)

PMID Year Title
27693370 2016 CASZ1 loss-of-function mutation associated with congenital heart disease.
26296975 2015 Zinc finger transcription factor CASZ1 interacts with histones, DNA repair proteins and recruits NuRD complex to regulate gene transcription.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
23892435 2013 CASZ1 inhibits cell cycle progression in neuroblastoma by restoring pRb activity.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23639441 2013 CASZ1 promotes vascular assembly and morphogenesis through the direct regulation of an EGFL7/RhoA-mediated pathway.
22331471 2012 Characterization of critical domains within the tumor suppressor CASZ1 required for transcriptional regulation and growth suppression.
22262398 2012 Loss of gene function as a consequence of human papillomavirus DNA integration.
22068036 2012 EZH2 Mediates epigenetic silencing of neuroblastoma suppressor genes CASZ1, CLU, RUNX3, and NGFR.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
More...