Property Summary

NCBI Gene PubMed Count 27
PubMed Score 103.20
PubTator Score 22.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 2.2e-03
ductal carcinoma in situ 2.300 4.3e-04
Endometriosis -1.346 2.6e-02
ependymoma 1.700 9.5e-04
gastric carcinoma -1.200 3.6e-02
group 3 medulloblastoma 2.000 6.8e-03
interstitial cystitis -1.300 2.8e-03
intraductal papillary-mucinous adenoma (... 1.900 9.3e-04
intraductal papillary-mucinous carcinoma... 1.700 9.9e-04
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-02
invasive ductal carcinoma 2.200 4.3e-03
lung adenocarcinoma -1.300 5.1e-10
medulloblastoma, large-cell 2.900 5.4e-04
osteosarcoma -2.703 4.1e-06
ovarian cancer 1.100 1.9e-04
pituitary cancer -1.100 9.6e-03
psoriasis 1.200 2.4e-04
spina bifida -1.032 3.4e-02

Gene RIF (15)

AA Sequence

MDLGTAEGTRCTDPPAGKPAMAPKRKGGLKLNAICAKLSRQVVVEKRADAGSHTEGSPSQPRDQERSGPE      1 - 70
SGAARAPRSEEDKRRAVIEKWVNGEYSEEPAPTPVLGRIAREGLELPPEGVYMVQPQGCSDEEDHAEEPS     71 - 140
KDGGALEEKDSDGAASKEDSGPSTRQASGEASSLRDYAASTMTEFLGMFGYDDQNTRDELARKISFEKLH    141 - 210
AGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKEVVGTLPGLRLPS    211 - 280
STAHLETKATILPLPSHSSVQMQNLVARASKYDFFIQKLKTGENLRPQNGSTYKKPSKYDLENVKYLHLF    281 - 350
KPGEGSPDMGGAIAFKTGKVGRPSKYDVRGIQKPGPAKVPPTPSLAPAPLASVPSAPSAPGPGPEPPASL    351 - 420
SFNTPEYLKSTFSKTDSITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHIHCAYQYREHY    421 - 490
HCLDPECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCMQVGCNK    491 - 560
VYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCRRPGCTFTFKNKCDIEKH    561 - 630
KSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIRAGCGFTFTSTSQMTSHKRKHERRHIRSS    631 - 700
GALGLPPSLLGAKDTEHEESSNDDLVDFSALSSKNSSLSASPTSQQSSASLAAATAATEAGPSATKPPNS    701 - 770
KISGLLPQGLPGSIPLALALSNSGLPTPTPYFPILAGRGSTSLPVGTPSLLGAVSSGSAASATPDTPTLV    771 - 840
ASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVK    841 - 910
PEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEG    911 - 980
SPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIK    981 - 1050
HANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWK   1051 - 1120
QLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQENDPCLATDCKYANKFHFHCLFGNCK   1121 - 1190
YVCKTSGKAESHCLDHINPNNNLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLP   1191 - 1260
WHIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSHARKHMRRMLG   1261 - 1330
KNFDRVPPSQGPPGLMDAETDECMDYTGCSPGAMSSESSTMDRSCSSTPVGNESTAAGNTISMPTASGAK   1331 - 1400
KRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFDLYEDCKDAACQFSLKVTHYHCTRENCGYKFCG   1401 - 1470
RTHMYKHAQHHDRVDNLVLDDFKRFKASLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQ   1471 - 1540
DVISAAGFCQFSSSADCAVPDCKYKLKCSHFHCTFPGCRHTVVGMSQMDSHKRKHEKQERGEPAAEGPAP   1541 - 1610
GPPISLDGSLSLGAEPGSLLFLQSAAAGLGLALGDAGDPGPPDAAAPGPREGAAAAAAAAGESSQEDEEE   1611 - 1680
ELELPEEEAEDDEDEDDDEDDDDEDDDEDDDDEDLRTDSEESLPEAAAEAAGAGARTPALAALAALGAPG   1681 - 1750
PAPTAASSP                                                                1751 - 1759
//

Text Mined References (30)

PMID Year Title