Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.06
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 2.3e-02
atypical teratoid / rhabdoid tumor -1.700 3.1e-06
glioblastoma -1.200 1.6e-02
medulloblastoma, large-cell -1.300 3.0e-02
osteosarcoma -2.985 3.9e-05
ovarian cancer 1.600 2.5e-03
sonic hedgehog group medulloblastoma 1.200 1.1e-02
subependymal giant cell astrocytoma -2.149 3.6e-02

Gene RIF (2)

AA Sequence

MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQA      1 - 70
TVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDE     71 - 140
LAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDD    141 - 210
VSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVR    211 - 280
HITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLG    281 - 350
PPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC    351 - 420
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVG    421 - 490
IRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPEDPRGEAEELGEDDEGLAPEDA    491 - 560
LLADDKDEEDSPRPRSPPGGPDKDFAWLS                                             561 - 589
//

Text Mined References (13)

PMID Year Title