Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
R01 Count 2
Funding $466,423.66
PubMed Score 9.82
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -3.375 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.200 0.016
medulloblastoma, large-cell -1.300 0.030
adult high grade glioma -1.100 0.023
sonic hedgehog group medulloblastoma 1.200 0.011
subependymal giant cell astrocytoma -2.149 0.036
ovarian cancer 1.600 0.002

Synonym

Accession Q86UZ6 E1P5K9 Q5JWJ3 Q6GMV4 Q9BQK3 Q9H3Z8 Q9H3Z9
Symbols BZEL
BTBD4
RINZF
ZNF340
dJ583P15.7
dJ583P15.8

Gene

Gene RIF (1)

PMID Text
23739915 A single nucleotide polymorphisn in ZBTB46, rs6062314, is associated with an increased genetic risk for multiple sclerosis.

AA Sequence

MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSEQA      1 - 70
TVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDE     71 - 140
LAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHDGGSSYGKEDQEPKADGPDD    141 - 210
VSSQPLWPGDVGYGPLRIKEEQVSPSQYGGSELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVR    211 - 280
HITQQVEDDSRASSPVPSFLPTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLG    281 - 350
PPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC    351 - 420
PYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVG    421 - 490
IRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPEDPRGEAEELGEDDEGLAPEDA    491 - 560
LLADDKDEEDSPRPRSPPGGPDKDFAWLS                                             561 - 589
//

Text Mined References (11)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23739915 2013 MANBA, CXCR5, SOX8, RPS6KB1 and ZBTB46 are genetic risk loci for multiple sclerosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
More...