Property Summary

NCBI Gene PubMed Count 7
PubMed Score 54.12
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 3.9e-02
atypical teratoid / rhabdoid tumor -1.600 6.7e-07
group 3 medulloblastoma -1.700 1.2e-03
malignant mesothelioma 1.200 6.2e-06
medulloblastoma, large-cell -1.400 1.0e-02
osteosarcoma 1.169 2.3e-06
ovarian cancer -1.100 5.6e-04
primitive neuroectodermal tumor -1.700 4.9e-04

Synonym

Accession Q86UY8 Q9NUM7 Q9P2T2 Q9P2T3
Symbols TU12B1TY
TU12B1-TY

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEE      1 - 70
LVPSIMSNLLNPDAIFSNNEMSLSDIEIYGFDYDYTLVFYSKHLHTLIFNAARDLLINEHRYPAEIRKYE     71 - 140
YDPNFAIRGLHYDVQRAVLMKIDAFHYIQLGTVYRGLSVVPDEEVIEMYEGSHVPLEQMSDFYGKSSHGN    141 - 210
TMKQFMDIFSLPEMTLLSCVNEYFLKNNIDYEPVHLYKDVKDSIRDVHIKGIMYRAIEADIEKYICYAEQ    211 - 280
TRAVLAKLADHGKKMFLITNSPSSFVDKGMSYIVGKDWRDLFDVVIVQAEKPNFFNDKRRPFRKMNEKGV    281 - 350
LLWDKIHKLQKGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIM    351 - 420
NTEQYIQTMTWLQTLTGLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQNPTYFL    421 - 490
RRLSRFADIYMASLSCLLNYDVSHTFYPRRTPLQHELPAWSERPPTFGTPLLQEAQAK                491 - 548
//

Text Mined References (9)

PMID Year Title