Property Summary

NCBI Gene PubMed Count 7
PubMed Score 52.08
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.74064687636668E-7
osteosarcoma 7933 2.34281092826179E-6
malignant mesothelioma 3163 6.165746803787E-6
medulloblastoma 1524 3.51665320292167E-4
primitive neuroectodermal tumor 3031 4.8561154692417E-4
ovarian cancer 8492 5.62189097466882E-4
medulloblastoma, large-cell 6234 0.0101764443826108
astrocytic glioma 2241 0.0392618299839601
Disease Target Count Z-score Confidence
Cone dystrophy 59 3.133 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytic glioma 1.100 0.039
osteosarcoma 1.169 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.010
primitive neuroectodermal tumor -1.700 0.000
ovarian cancer -1.100 0.001

Synonym

Accession Q86UY8 Q9NUM7 Q9P2T2 Q9P2T3
Symbols TU12B1TY
TU12B1-TY

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG

Gene RIF (1)

PMID Text
15547748 TU12B1-TY may contribute to the development and/or progression of human pancreatic cancer

AA Sequence

MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEE      1 - 70
LVPSIMSNLLNPDAIFSNNEMSLSDIEIYGFDYDYTLVFYSKHLHTLIFNAARDLLINEHRYPAEIRKYE     71 - 140
YDPNFAIRGLHYDVQRAVLMKIDAFHYIQLGTVYRGLSVVPDEEVIEMYEGSHVPLEQMSDFYGKSSHGN    141 - 210
TMKQFMDIFSLPEMTLLSCVNEYFLKNNIDYEPVHLYKDVKDSIRDVHIKGIMYRAIEADIEKYICYAEQ    211 - 280
TRAVLAKLADHGKKMFLITNSPSSFVDKGMSYIVGKDWRDLFDVVIVQAEKPNFFNDKRRPFRKMNEKGV    281 - 350
LLWDKIHKLQKGQIYKQGNLYEFLKLTGWRGSRVLYFGDHIYSDLADLTLKHGWRTGAIIPELRSELKIM    351 - 420
NTEQYIQTMTWLQTLTGLLEQMQVHRDAESQLVLQEWKKERKEMREMTKSFFNAQFGSLFRTDQNPTYFL    421 - 490
RRLSRFADIYMASLSCLLNYDVSHTFYPRRTPLQHELPAWSERPPTFGTPLLQEAQAK                491 - 548
//

Text Mined References (9)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
21878436 2011 A genome-wide association study identifies a region at chromosome 12 as a potential susceptibility locus for restenosis after percutaneous coronary intervention.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
15827139 2005 The common viral insertion site Evi12 is located in the 5'-noncoding region of Gnn, a novel gene with enhanced expression in two subclasses of human acute myeloid leukemia.
15547748 2004 TU12B1-TY, a novel gene in the region at 12q22-q23.1 frequently deleted in pancreatic cancer, shows reduced expression in pancreatic cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.