Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.67
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis 1.100 0.001
osteosarcoma 3.050 0.000
group 3 medulloblastoma 1.700 0.006
astrocytoma 1.300 0.021
primitive neuroectodermal tumor 1.100 0.003
intraductal papillary-mucinous neoplasm ... 1.200 0.008
lung cancer 2.300 0.000
colon cancer 1.300 0.012
aldosterone-producing adenoma -1.308 0.013
ovarian cancer 1.800 0.000

Gene RIF (4)

PMID Text
26666750 findings reveal an anti-apoptotic role for Naa40 and exhibit its potential as a therapeutic target in colorectal cancers.
24248912 The knowledge of detailed molecular architecture of Patt1 is not only the key to understanding its mechanistic functional properties but it also opens the possibility of rational drug and protein design experiments
21935442 Results strongly suggest that human Naa40p/NatD is conserved from yeast. Thus, the NATs of all classes of N-terminally acetylated proteins in humans now appear to be accounted for.
19695338 a novel protein acetyltransferase Patt1 might be involved in the development of hepatocellular carcinoma

AA Sequence

MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV      1 - 70
DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV     71 - 140
QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS    141 - 210
YEILSRRTKFGDSHHSHAGGHCGGCCH                                               211 - 237
//

Text Mined References (13)

PMID Year Title
26666750 2016 Depletion of histone N-terminal-acetyltransferase Naa40 induces p53-independent apoptosis in colorectal cancer cells via the mitochondrial pathway.
24248912 2013 Structure of Patt1 human proapoptotic histone acetyltransferase.
21935442 2011 The human N-alpha-acetyltransferase 40 (hNaa40p/hNatD) is conserved from yeast and N-terminally acetylates histones H2A and H4.
19695338 2009 Patt1, a novel protein acetyltransferase that is highly expressed in liver and downregulated in hepatocellular carcinoma, enhances apoptosis of hepatoma cells.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...