Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.67
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.308 1.3e-02
astrocytoma 1.300 2.1e-02
colon cancer 1.300 1.2e-02
group 3 medulloblastoma 1.600 8.5e-05
intraductal papillary-mucinous neoplasm ... 1.200 7.7e-03
lung cancer 1.400 1.2e-03
malignant mesothelioma 1.700 7.7e-07
osteosarcoma 3.050 1.2e-07
ovarian cancer 1.800 1.7e-05
primitive neuroectodermal tumor 1.100 2.6e-03
psoriasis 1.100 6.3e-04

Gene RIF (4)

AA Sequence

MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATV      1 - 70
DWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEV     71 - 140
QLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCS    141 - 210
YEILSRRTKFGDSHHSHAGGHCGGCCH                                               211 - 237
//

Text Mined References (15)

PMID Year Title