Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $93,510.25
PubMed Score 7.91
PubTator Score 4.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.966 0.000
non-small cell lung cancer 2.193 0.000
pancreatic cancer 1.200 0.010
lung adenocarcinoma 2.000 0.000
psoriasis 2.600 0.000
spina bifida -1.079 0.048

Gene RIF (3)

PMID Text
22886303 FAM83A interacted with and caused phosphorylation of c-RAF and PI3K p85, upstream of MAPK and downstream of EGFR.
18514066 The diagnostic value of BJ-TSA-9 was explored in combination with other known lung cancer markers for the detection of circulating cancer cells in lung cancer patients.
16354590 Over-expression of BJ-TSA-9 is associated with lung cancer

AA Sequence

MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQY      1 - 70
IQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHSWASAEKPYLKEKSSATVYFQ     71 - 140
TVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQI    141 - 210
SDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVE    211 - 280
LFDEEFRHLYASSKPVMGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVS    281 - 350
ASSGPCSPAAPHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL    351 - 420
TPTWRPFLQASPHF                                                            421 - 434
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24736947 2014 Conserved oncogenic behavior of the FAM83 family regulates MAPK signaling in human cancer.
24578125 2014 Common variants in UMOD associate with urinary uromodulin levels: a meta-analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22886303 2012 FAM83A confers EGFR-TKI resistance in breast cancer cells and in mice.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18514066 2008 Detection of circulating cancer cells in lung cancer patients with a panel of marker genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16354590 2005 BJ-TSA-9, a novel human tumor-specific gene, has potential as a biomarker of lung cancer.
More...