Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.55
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.4e-32
non-small cell lung cancer 2890 1.8e-11
lung adenocarcinoma 2716 1.5e-09
osteosarcoma 7950 2.6e-07
pancreatic cancer 2398 1.0e-02
spina bifida 1074 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma 1.200 1.5e-09
non-small cell lung cancer 2.193 1.8e-11
osteosarcoma 1.966 2.6e-07
pancreatic cancer 1.200 1.0e-02
psoriasis 1.400 5.4e-32
spina bifida -1.079 4.8e-02

Gene RIF (4)

AA Sequence

MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQY      1 - 70
IQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHSWASAEKPYLKEKSSATVYFQ     71 - 140
TVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQI    141 - 210
SDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVE    211 - 280
LFDEEFRHLYASSKPVMGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVS    281 - 350
ASSGPCSPAAPHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL    351 - 420
TPTWRPFLQASPHF                                                            421 - 434
//

Text Mined References (15)

PMID Year Title