Property Summary

NCBI Gene PubMed Count 56
Grant Count 31
R01 Count 11
Funding $4,040,742.78
PubMed Score 71.65
PubTator Score 68.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.095 0.002
non-small cell lung cancer -1.362 0.000
interstitial cystitis 1.700 0.001
subependymal giant cell astrocytoma 1.791 0.011
lung carcinoma -1.500 0.000

 GO Function (1)

Gene RIF (45)

PMID Text
27101375 NMR studies demonstrated that the F1 loop of kindlin-3 is globally unfolded but stretches of residues assuming transient helical conformations could be detected in aqueous solution.
26994136 kindlin-3 plays an important role in maintaining a proper conformation of the resting alpha4beta1 to mediate both rolling and firm cell adhesion
26677948 Kindlin-3 regulates c-Myc protein expression in the human chronic myeloid leukemia cell line K562.
26334393 Suppression of the Kindlin-2-integrin beta1-AKT regulatory axis is an alternative mechanism underlying the tumor suppressor function of miR-200b in esophageal squamous cell carcinoma.
26282877 The accumulation of HSPCs in the circulation of leukocyte adhesion deficiency type III patients, who lack Kindlin-3, underlines the conserved functions of Kindlin-3 in man and the importance of our findings for human disease.
26188538 Kindlin-3/FERMT3 is upregulated in atherosclerotic, mainly in cells of monocytic origin and of M2 type. Simultaneous upregulation of ITGB2 suggests a synergistic effect on leukocyte adherence and transmigration into the vessel wall.
25854317 A new C>T point mutation was found in exon 13 in the FERMT3 gene in an infant diagnosed with LAD-III. KINDLIN-3 expression is required for platelet aggregation and leukocyte function, but also osteoclast-mediated bone resorption.
25724625 High Kindlin-2 expression promotes pancreatic ductal adenocarcinoma progression.
25609252 These data identify a role of kindlin-3 phosphorylation in integrin b3 activation and provide a basis for functional differences between kindlin-3 and the two other kindlin paralogs.
25344860 The data uncover a novel and unexpected tumor suppressor role of Kindlin-3 which can influence integrins targeted therapies development.
More...

AA Sequence

MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKR      1 - 70
QWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELS     71 - 140
LLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLL    141 - 210
QRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLL    211 - 280
LEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP    281 - 350
ELKDHLRIFRIPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF    351 - 420
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNH    421 - 490
PHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMV    491 - 560
RFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRI    561 - 630
VHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF                                     631 - 667
//

Text Mined References (62)

PMID Year Title
27101375 2016 NMR Characterization and Membrane Interactions of the Loop Region of Kindlin-3 F1 Subdomain.
26994136 2016 Kindlin-3 Is Essential for the Resting ?4?1 Integrin-mediated Firm Cell Adhesion under Shear Flow Conditions.
26677948 2015 Kindlin-3 interacts with the ribosome and regulates c-Myc expression required for proliferation of chronic myeloid leukemia cells.
26359933 2016 Adaptive immune defects in a patient with leukocyte adhesion deficiency type III with a novel mutation in FERMT3.
26334393 2015 Loss of miR-200b promotes invasion via activating the Kindlin-2/integrin ?1/AKT pathway in esophageal squamous cell carcinoma: An E-cadherin-independent mechanism.
26282877 2015 Kindlin-3-mediated integrin adhesion is dispensable for quiescent but essential for activated hematopoietic stem cells.
26188538 2015 Kindlin 3 (FERMT3) is associated with unstable atherosclerotic plaques, anti-inflammatory type II macrophages and upregulation of beta-2 integrins in all major arterial beds.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854317 2015 A new mutation in the KINDLIN-3 gene ablates integrin-dependent leukocyte, platelet, and osteoclast function in a patient with leukocyte adhesion deficiency-III.
25724625 2015 Kindlin-2 induced by TGF-? signaling promotes pancreatic ductal adenocarcinoma progression through downregulation of transcriptional factor HOXB9.
More...