Property Summary

NCBI Gene PubMed Count 56
PubMed Score 71.65
PubTator Score 68.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.095 0.002
non-small cell lung cancer -1.362 0.000
interstitial cystitis 1.700 0.001
subependymal giant cell astrocytoma 1.791 0.011
lung carcinoma -1.500 0.000

Synonym

Accession Q86UX7 Q8IUA1 Q8N207 Q9BT48
Symbols URP2
KIND3
MIG-2
MIG2B
URP2SF
UNC112C

Gene

PDB

2YS3  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

 GO Function (1)

Gene RIF (45)

PMID Text
27101375 NMR studies demonstrated that the F1 loop of kindlin-3 is globally unfolded but stretches of residues assuming transient helical conformations could be detected in aqueous solution.
26994136 kindlin-3 plays an important role in maintaining a proper conformation of the resting alpha4beta1 to mediate both rolling and firm cell adhesion
26677948 Kindlin-3 regulates c-Myc protein expression in the human chronic myeloid leukemia cell line K562.
26334393 Suppression of the Kindlin-2-integrin beta1-AKT regulatory axis is an alternative mechanism underlying the tumor suppressor function of miR-200b in esophageal squamous cell carcinoma.
26282877 The accumulation of HSPCs in the circulation of leukocyte adhesion deficiency type III patients, who lack Kindlin-3, underlines the conserved functions of Kindlin-3 in man and the importance of our findings for human disease.
26188538 Kindlin-3/FERMT3 is upregulated in atherosclerotic, mainly in cells of monocytic origin and of M2 type. Simultaneous upregulation of ITGB2 suggests a synergistic effect on leukocyte adherence and transmigration into the vessel wall.
25854317 A new C>T point mutation was found in exon 13 in the FERMT3 gene in an infant diagnosed with LAD-III. KINDLIN-3 expression is required for platelet aggregation and leukocyte function, but also osteoclast-mediated bone resorption.
25724625 High Kindlin-2 expression promotes pancreatic ductal adenocarcinoma progression.
25609252 These data identify a role of kindlin-3 phosphorylation in integrin b3 activation and provide a basis for functional differences between kindlin-3 and the two other kindlin paralogs.
25344860 The data uncover a novel and unexpected tumor suppressor role of Kindlin-3 which can influence integrins targeted therapies development.
More...

AA Sequence

MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKR      1 - 70
QWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELS     71 - 140
LLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLL    141 - 210
QRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLL    211 - 280
LEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP    281 - 350
ELKDHLRIFRIPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF    351 - 420
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNH    421 - 490
PHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMV    491 - 560
RFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRI    561 - 630
VHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF                                     631 - 667
//

Text Mined References (62)

PMID Year Title
27101375 2016 NMR Characterization and Membrane Interactions of the Loop Region of Kindlin-3 F1 Subdomain.
26994136 2016 Kindlin-3 Is Essential for the Resting ?4?1 Integrin-mediated Firm Cell Adhesion under Shear Flow Conditions.
26677948 2015 Kindlin-3 interacts with the ribosome and regulates c-Myc expression required for proliferation of chronic myeloid leukemia cells.
26359933 2016 Adaptive immune defects in a patient with leukocyte adhesion deficiency type III with a novel mutation in FERMT3.
26334393 2015 Loss of miR-200b promotes invasion via activating the Kindlin-2/integrin ?1/AKT pathway in esophageal squamous cell carcinoma: An E-cadherin-independent mechanism.
26282877 2015 Kindlin-3-mediated integrin adhesion is dispensable for quiescent but essential for activated hematopoietic stem cells.
26188538 2015 Kindlin 3 (FERMT3) is associated with unstable atherosclerotic plaques, anti-inflammatory type II macrophages and upregulation of beta-2 integrins in all major arterial beds.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854317 2015 A new mutation in the KINDLIN-3 gene ablates integrin-dependent leukocyte, platelet, and osteoclast function in a patient with leukocyte adhesion deficiency-III.
25724625 2015 Kindlin-2 induced by TGF-? signaling promotes pancreatic ductal adenocarcinoma progression through downregulation of transcriptional factor HOXB9.
More...