Property Summary

NCBI Gene PubMed Count 57
PubMed Score 75.95
PubTator Score 68.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 1.700 6.6e-04
lung carcinoma -1.500 2.5e-23
non-small cell lung cancer -1.362 4.8e-14
osteosarcoma -2.095 2.1e-03
subependymal giant cell astrocytoma 1.791 1.1e-02

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (46)

AA Sequence

MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWSDHAIWWEQKR      1 - 70
QWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPLFQAVAAICRLLSIRHPEELS     71 - 140
LLRAPEKKEKKKKEKEPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQTEACYHMLSRPQPPPDPLLL    141 - 210
QRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLL    211 - 280
LEEIDCTEEEMMVFAALQYHINKLSQSGEVGEPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIP    281 - 350
ELKDHLRIFRIPRRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKF    351 - 420
CIKLLVPSPEGMSEIYLRCQDEQQYARWMAGCRLASKGRTMADSSYTSEVQAILAFLSLQRTGSGGPGNH    421 - 490
PHGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGISYVMV    491 - 560
RFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRI    561 - 630
VHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF                                     631 - 667
//

Text Mined References (62)

PMID Year Title