Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.41
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
lung cancer -3.000 1.1e-05
Breast cancer -2.600 5.2e-47
breast carcinoma -2.100 8.8e-04
colon cancer -2.400 9.6e-05
ductal carcinoma in situ -3.000 2.8e-04
ependymoma 1.300 1.9e-02
fibroadenoma -2.300 1.8e-03
head and neck cancer -1.200 3.4e-02
intraductal papillary-mucinous adenoma (... -2.300 1.2e-04
intraductal papillary-mucinous carcinoma... -2.500 3.8e-04
intraductal papillary-mucinous neoplasm ... -2.600 1.1e-04
invasive ductal carcinoma -1.262 2.2e-03
lung adenocarcinoma -1.200 3.9e-14
non-small cell lung cancer -1.206 8.4e-20
osteosarcoma -2.099 3.4e-02
pituitary cancer 1.100 9.3e-04
sonic hedgehog group medulloblastoma 1.100 1.0e-02
urothelial carcinoma 1.500 3.8e-02

Gene RIF (17)

AA Sequence

MLLLLGLCLGLSLCVGSQEEAQSWGHSSEQDGLRVPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVS      1 - 70
CRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEI     71 - 140
FRASAVIPSKDKAAFFLSYEELLQRRLGKYEHSISVRPQQLSGRLSVDVNILESAGIASLEVLPLHNSRQ    141 - 210
RGSGRGEDDSGPPPSTVINQNETFANIIFKPTVVQQARIAQNGILGDFIIRYDVNREQSIGDIQVLNGYF    211 - 280
VHYFAPKDLPPLPKNVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKVWKDHLISV    281 - 350
TPDSIRDGKVYIHHMSPTGGTDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKIL    351 - 420
NNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLIGFYDEIRTPLLSDIRIDY    421 - 490
PPSSVVQATKTLFPNYFNGSEIIIAGKLVDRKLDHLHVEVTASNSKKFIILKTDVPVRPQKAGKDVTGSP    491 - 560
RPGGDGEGDTNHIERLWSYLTTKELLSSWLQSDDEPEKERLRQRAQALAVSYRFLTPFTSMKLRGPVPRM    561 - 630
DGLEEAHGMSAAMGPEPVVQSVRGAGTQPGPLLKKPYQPRIKISKTSVDGDPHFVVDFPLSRLTVCFNID    631 - 700
GQPGDILRLVSDHRDSGVTVNGELIGAPAPPNGHKKQRTYLRTITILINKPERSYLEITPSRVILDGGDR    701 - 770
LVLPCNQSVVVGSWGLEVSVSANANVTVTIQGSIAFVILIHLYKKPAPFQRHHLGFYIANSEGLSSNCHG    771 - 840
LLGQFLNQDARLTEDPAGPSQNLTHPLLLQVGEGPEAVLTVKGHQVPVVWKQRKIYNGEEQIDCWFARNN    841 - 910
AAKLIDGEYKDYLAFHPFDTGMTLGQGMSREL                                          911 - 942
//

Text Mined References (28)

PMID Year Title