Property Summary

NCBI Gene PubMed Count 23
Grant Count 1
Funding $31,145.83
PubMed Score 12.75
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
27143355 The current study describes a novel mechanism linking the TSG-6 transfer of the newly described HC5 to the HA-dependent control of cell phenotype. The interaction of HC5 with cell surface HA was essential for TGFbeta1-dependent differentiation of fibroblasts to myofibroblasts, highlighting its importance as a novel potential therapeutic target.
26252352 ITIH5 may be a novel putative tumor suppressor gene in NSCLC with a potential molecular significance in the squamoid ADC subtype and further clinical impact for risk stratification of adenocarcinoma patients.
25809190 Hence, we can strengthen the presumption that ITIH5 may constitute a novel regulatory molecule of the human skin that could play an important role in in fl ammation via its interaction with hyaluronic acid.
25093535 ITIH5 is a novel putative tumor suppressor gene in colon cancer with a potential impact in the CIMP-related pathway.
24913813 ITIH5 expression is decreased in gastric cancer and that low expression of this protein is associated with poor clinical outcome.
24265292 provide evidence that down-regulation of ITIH5 by aberrant DNA hypermethylation may provoke invasive phenotypes in human bladder cancer
23320751 Tumor-specific methylation of the three-gene panel (ITIH5, DKK3, and RASSF1A) might be a valuable biomarker for the early detection of breast cancer.
22616691 ITIH5 gene expression is regulated both by obesity and by the region between visceral and subcutaneous adipose tissue.
21852814 ITIH-5 is highly expressed in sc adipose tissue, increased in obesity, down regulated after weight loss, and associated with measures of body size and metabolism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MLLLLGLCLGLSLCVGSQEEAQSWGHSSEQDGLRVPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVS      1 - 70
CRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEI     71 - 140
FRASAVIPSKDKAAFFLSYEELLQRRLGKYEHSISVRPQQLSGRLSVDVNILESAGIASLEVLPLHNSRQ    141 - 210
RGSGRGEDDSGPPPSTVINQNETFANIIFKPTVVQQARIAQNGILGDFIIRYDVNREQSIGDIQVLNGYF    211 - 280
VHYFAPKDLPPLPKNVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKVWKDHLISV    281 - 350
TPDSIRDGKVYIHHMSPTGGTDINGALQRAIRLLNKYVAHSGIGDRSVSLIVFLTDGKPTVGETHTLKIL    351 - 420
NNTREAARGQVCIFTIGIGNDVDFRLLEKLSLENCGLTRRVHEEEDAGSQLIGFYDEIRTPLLSDIRIDY    421 - 490
PPSSVVQATKTLFPNYFNGSEIIIAGKLVDRKLDHLHVEVTASNSKKFIILKTDVPVRPQKAGKDVTGSP    491 - 560
RPGGDGEGDTNHIERLWSYLTTKELLSSWLQSDDEPEKERLRQRAQALAVSYRFLTPFTSMKLRGPVPRM    561 - 630
DGLEEAHGMSAAMGPEPVVQSVRGAGTQPGPLLKKPYQPRIKISKTSVDGDPHFVVDFPLSRLTVCFNID    631 - 700
GQPGDILRLVSDHRDSGVTVNGELIGAPAPPNGHKKQRTYLRTITILINKPERSYLEITPSRVILDGGDR    701 - 770
LVLPCNQSVVVGSWGLEVSVSANANVTVTIQGSIAFVILIHLYKKPAPFQRHHLGFYIANSEGLSSNCHG    771 - 840
LLGQFLNQDARLTEDPAGPSQNLTHPLLLQVGEGPEAVLTVKGHQVPVVWKQRKIYNGEEQIDCWFARNN    841 - 910
AAKLIDGEYKDYLAFHPFDTGMTLGQGMSREL                                          911 - 942
//

Text Mined References (26)

PMID Year Title
27143355 2016 Tumor Necrosis Factor-stimulated Gene 6 (TSG-6)-mediated Interactions with the Inter-?-inhibitor Heavy Chain 5 Facilitate Tumor Growth Factor ?1 (TGF?1)-dependent Fibroblast to Myofibroblast Differentiation.
26252352 2015 Low expression of ITIH5 in adenocarcinoma of the lung is associated with unfavorable patients' outcome.
25809190 2015 Inter-?-trypsin inhibitor heavy chain 5 (ITIH5) is overexpressed in inflammatory skin diseases and affects epidermal morphology in constitutive knockout mice and murine 3D skin models.
25093535 2014 Epigenetic inactivation of the novel candidate tumor suppressor gene ITIH5 in colon cancer predicts unfavorable overall survival in the CpG island methylator phenotype.
24913813 2014 Decreased ITIH5 expression is associated with poor prognosis in primary gastric cancer.
24265292 2014 Epigenetic inactivation of ITIH5 promotes bladder cancer progression and predicts early relapse of pT1 high-grade urothelial tumours.
23320751 2013 Promoter hypermethylation of the tumor-suppressor genes ITIH5, DKK3, and RASSF1A as novel biomarkers for blood-based breast cancer screening.
22616691 2012 Functional annotation of the human fat cell secretome.
21852814 2012 ITIH-5 expression in human adipose tissue is increased in obesity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...