Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.57
PubTator Score 3.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (2)

AA Sequence

MVCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRY      1 - 70
HYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGR     71 - 140
YECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCN    141 - 210
AGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKP    211 - 280
LRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLG    281 - 350
FPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV                      351 - 402
//

Text Mined References (9)

PMID Year Title