Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.98
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.100 6.9e-03
astrocytic glioma -1.900 1.6e-02
Astrocytoma, Pilocytic -2.800 1.5e-06
atypical teratoid / rhabdoid tumor -3.400 3.1e-05
Breast cancer -1.200 5.0e-03
ependymoma -3.000 4.7e-03
glioblastoma -2.300 8.3e-06
lung carcinoma -1.600 1.6e-26
malignant mesothelioma -1.500 1.0e-06
medulloblastoma -1.700 3.6e-03
medulloblastoma, large-cell -4.100 6.2e-06
mucosa-associated lymphoid tissue lympho... 1.439 2.9e-02
Multiple myeloma 1.064 3.2e-02
non-small cell lung cancer -1.016 6.2e-09
oligodendroglioma -1.800 3.1e-02
osteosarcoma -1.537 5.9e-03
ovarian cancer -3.100 2.3e-10
primitive neuroectodermal tumor -3.200 4.3e-04
psoriasis -2.000 2.3e-04
subependymal giant cell astrocytoma -4.458 4.4e-03

Gene RIF (12)

AA Sequence

MLDPSSSEEESDEGLEEESRDVLVAAGSSQRAPPAPTREGRRDAPGRAGGGGAARSVSPSPSVLSEGRDE      1 - 70
PQRQLDDEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQQLQLLKERFQAFLNGETQIVADE     71 - 140
AFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVFKKNIEKRVRSLPEIDGLSKETVLSSWIAKYDAI    141 - 210
YRGEEDLCKQPNRMALSAVSELILSKEQLYEMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGR    211 - 280
LQLADKMAKERKFPKFIAKDMENMYIEELRSSVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDIGD    281 - 350
ENEIQLSKSDVVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGEKLQTDQAEASRPQWGTQGDFTTTHP    351 - 420
RPVVKVKLFTESTGVLALEDKELGRVILYPTSNSSKSAELHRMVVPKNSQDSDLKIKLAVRMDKPAHMKH    421 - 490
SGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELMQLEGYTVDYTDPHPGLQGGCMFFN    491 - 560
AVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPVPAIQTQKLNPKGGTLHADAQLSGKDADRFQKHGM    561 - 630
DEFISANPCKLDHAFLFRILQRQTLDHRLNDSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLAELM    631 - 700
EHSENGAVIDPTLLHYSFAFCASHVHGNRPDGIGTVSVEEKERFEEIKERLSSLLENQISHFRYCFPFGR    701 - 770
PEGALKATLSLLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEETMNQASPARKLEEI    771 - 840
LHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWALFTVDMDTALEAQPQDSWDSFPLFQLLNN    841 - 910
FLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQPVKNIANSLPNVALPKVPSL    911 - 980
PLNLPQIPNISTASWMPSLYESTNGSATSEDLFWKLDALQMFVFDLHWPEQEFAHHLEQRLKLMASDMLE    981 - 1050
ACVKRTRTAFELKLQKASKTTDLRIPASVCTMFNVLVDAKKQSTKLCALDGGQEQQYHSKIDDLIDNSVK   1051 - 1120
EIISLLVSKFVSVLEGVLSKLSRYDEGTFFSSILSFTVKAAAKYVDVPKPGMDLADTYIMFVRQNQDILR   1121 - 1190
EKVNEEMYIEKLFDQWYSSSMKVICVWLTDRLDLQLHIYQLKTLIKIVKKTYRDFRLQGVLEGTLNSKTY   1191 - 1260
DTVHRRLTVEEATASVSEGGGLQGITMKDSDEEEEG                                     1261 - 1296
//

Text Mined References (24)

PMID Year Title