Property Summary

NCBI Gene PubMed Count 17
Grant Count 20
R01 Count 20
Funding $2,121,239.33
PubMed Score 19.74
PubTator Score 11.89

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.866 0.034
ulcerative colitis -2.900 0.000

Gene RIF (13)

PMID Text
24703425 Hepatic OSTalpha-OSTbeta expression is induced by hypoxia.
24264050 OSTbeta is a target of RARalpha-mediated (by binding to DR5 response element) gene regulation pathways
22535958 Ostbeta is required for both proper trafficking of Ostalpha and formation of the functional transport unit, and identify specific residues of Ostbeta critical for these processes.
21691099 The present report summarizes the evidence for a pleiotropic role of Ostalpha-Ostbeta in different tissues.
20649839 OSTbeta is localized to steroidogenic cells of the brain and adrenal gland, and it modulates DHEA/DHEAS homeostasis
18847488 interaction of solute transporter beta with human organic solute transporter alpha.
18469300 The mRNA expression of OSTalpha-OSTbeta was significantly reduced (OSTalpha: 3.3-fold, P = 0.006; OSTbeta: 2.6-fold, P = 0.03) in normal-weight but not overweight gallstone carriers
17332473 Demonstrate association of OST-alpha and OST-beta to determine trafficking to plasma membrane and activity.
16423920 These results indicate that expression of Ostalpha and Ostbeta are highly regulated in response to cholestasis and that this response is dependent on the FXR bile acid receptor.
16317684 the selective localization of OSTalpha and OSTbeta to the basolateral plasma membrane of epithelial cells responsible for bile acid and sterol reabsorption.
More...

AA Sequence

MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP      1 - 70
EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES                 71 - 128
//

Publication (18)

PMID Year Title
24703425 2015 The organic solute transporters alpha and beta are induced by hypoxia in human hepatocytes.
24264050 2014 A novel RAR?/CAR-mediated mechanism for regulation of human organic solute transporter-? gene expression.
22535958 2012 ?-Subunit of the Ost?-Ost? organic solute transporter is required not only for heterodimerization and trafficking but also for function.
21691099 2011 Pleiotropic functions of the organic solute transporter Ost?-Ost?.
20649839 2010 Neurosteroid transport by the organic solute transporter OST?-OST?.
20538072 2010 Getting the mOST from OST: Role of organic solute transporter, OSTalpha-OSTbeta, in bile acid and steroid metabolism.
18847488 2008 N-Glycosylation of the alpha subunit does not influence trafficking or functional activity of the human organic solute transporter alpha/beta.
18469300 2008 Reduced ileal expression of OSTalpha-OSTbeta in non-obese gallstone disease.
17332473 2007 Protein-protein interactions and membrane localization of the human organic solute transporter.
16423920 2006 Upregulation of a basolateral FXR-dependent bile acid efflux transporter OSTalpha-OSTbeta in cholestasis in humans and rodents.
More...