Property Summary

NCBI Gene PubMed Count 18
PubMed Score 22.61
PubTator Score 11.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cholestasis 155 5.17 2.6
Liver Cirrhosis, Biliary 33 0.0 0.0
Disease Target Count
Biliary cirrhosis 45
Disease Target Count P-value
active ulcerative colitis 764 9.1e-03
active Crohn's disease 922 3.4e-02

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.866 3.4e-02
active ulcerative colitis -2.210 9.1e-03

Gene RIF (14)

AA Sequence

MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP      1 - 70
EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES                 71 - 128
//

Text Mined References (19)

PMID Year Title