Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.33
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Williams-Beuren syndrome 50 5.013 2.5

Expression

Gene RIF (1)

AA Sequence

MAWQVSLLELEDRLQCPICLEVFKESLMLQCGHSYCKGCLVSLSYHLDTKVRCPMCWQVVDGSSSLPNVS      1 - 70
LAWVIEALRLPGDPEPKVCVHHRNPLSLFCEKDQELICGLCGLLGSHQHHPVTPVSTVCSRMKEELAALF     71 - 140
SELKQEQKKVDELIAKLVKNRTRIVNESDVFSWVIRREFQELRHPVDEEKARCLEGIGGHTRGLVASLDM    141 - 210
QLEQAQGTRERLAQAECVLEQFGNEDHHEFIWKFHSMASR                                  211 - 250
//

Text Mined References (6)

PMID Year Title