Property Summary

NCBI Gene PubMed Count 16
Grant Count 12
Funding $2,145,598.49
PubMed Score 1.71
PubTator Score 2.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.018
astrocytic glioma 1.300 0.020
ependymoma 1.200 0.044
oligodendroglioma -1.400 0.019
osteosarcoma -1.881 0.000
atypical teratoid / rhabdoid tumor 1.100 0.002
glioblastoma -1.100 0.002
medulloblastoma, large-cell -1.300 0.000
adrenocortical carcinoma -1.301 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.001
group 3 medulloblastoma 1.100 0.025
aldosterone-producing adenoma -1.012 0.044
ovarian cancer 1.800 0.000

Gene RIF (4)

PMID Text
25486460 this study demonstrates that USP48 controls the Ubiquitin/proteasome-system-dependent turnover of activated NF-kappaB/RelA in the nucleus.
24308971 data demonstrate a crucial role for the dynamic interaction between D3R and USP48 in the regulation of NHE3 expression and function
16214042 The Overexpression of USP31 in HEK 293T cells inhibited TNFalpha, CD40, LMP1, TRAF2, TRAF6 and IKKbeta-mediated NF-kappaB activation, but did not inhibit Smad-mediated transcription activation.
15354349 Northern blot analysis revealed a single USP31 transcript of approximately 4 kb, which was primarily expressed in the testis and lung.

AA Sequence

MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDEN      1 - 70
SFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYE     71 - 140
PQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQ    141 - 210
QQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNAT    211 - 280
RKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAY    281 - 350
SGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL    351 - 420
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVS    421 - 490
LEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVE    491 - 560
RCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLN    561 - 630
KDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILER    631 - 700
EGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVG    701 - 770
NSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKL    771 - 840
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQS    841 - 910
NGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGK    911 - 980
ILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH                   981 - 1035
//

Text Mined References (23)

PMID Year Title
25486460 2015 CSN-associated USP48 confers stability to nuclear NF-?B/RelA by trimming K48-linked Ub-chains.
24308971 2014 Dopamine D3 receptor inhibits the ubiquitin-specific peptidase 48 to promote NHE3 degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...