Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.47
PubTator Score 2.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.301 2.1e-05
aldosterone-producing adenoma -1.012 4.4e-02
astrocytic glioma 1.300 2.0e-02
atypical teratoid / rhabdoid tumor 1.100 2.4e-03
ependymoma 1.200 4.4e-02
glioblastoma -1.100 1.9e-03
group 3 medulloblastoma 1.100 2.5e-02
intraductal papillary-mucinous adenoma (... 1.100 1.5e-03
medulloblastoma, large-cell -1.300 2.9e-04
oligodendroglioma -1.400 1.9e-02
osteosarcoma -1.877 3.6e-06
ovarian cancer -1.100 8.0e-05
Rheumatoid arthritis 1.100 1.8e-02

Protein-protein Interaction (6)

Gene RIF (4)

AA Sequence

MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDEN      1 - 70
SFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYE     71 - 140
PQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQ    141 - 210
QQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNAT    211 - 280
RKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAY    281 - 350
SGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL    351 - 420
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVS    421 - 490
LEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVE    491 - 560
RCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLN    561 - 630
KDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILER    631 - 700
EGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVG    701 - 770
NSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKL    771 - 840
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQS    841 - 910
NGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGK    911 - 980
ILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH                   981 - 1035
//

Text Mined References (23)

PMID Year Title