Property Summary

NCBI Gene PubMed Count 20
PubMed Score 37.87
PubTator Score 17.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
adult high grade glioma 3801 8.1e-03
Disease Target Count Z-score Confidence
Shipyard eye 15 5.63 2.8

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 8.1e-03
diabetes mellitus 1.500 1.1e-03

Gene RIF (12)

AA Sequence

MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKR      1 - 70
VGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE                                71 - 113
//

Text Mined References (24)

PMID Year Title