Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 9.2e-03
diabetes mellitus -1.100 1.6e-02
ependymoma 1.400 1.7e-02
oligodendroglioma 1.400 3.6e-03
osteosarcoma -1.607 8.7e-06
ovarian cancer -2.300 5.9e-10
Pick disease -2.500 5.6e-07
progressive supranuclear palsy -1.900 6.8e-03

AA Sequence

MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCG      1 - 70
CEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSY     71 - 140
EEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPA    141 - 210
PELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPD    211 - 280
RVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS                      281 - 332
//

Text Mined References (4)

PMID Year Title