Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 0.009
ependymoma 1.400 0.017
oligodendroglioma 1.400 0.004
osteosarcoma -1.607 0.000
diabetes mellitus -1.100 0.016
Pick disease -2.500 0.000
progressive supranuclear palsy -1.900 0.007
ovarian cancer -2.300 0.000

Synonym

Accession Q86UT8
Symbols DLNB14

Gene

 Compartment GO Term (0)

AA Sequence

MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCG      1 - 70
CEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSY     71 - 140
EEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPA    141 - 210
PELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPD    211 - 280
RVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS                      281 - 332
//

Text Mined References (4)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.