Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.02
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.85492211078435E-10
Pick disease 1893 5.56456432321098E-7
osteosarcoma 7933 8.71823649547302E-6
oligodendroglioma 2849 0.0035941486591071
progressive supranuclear palsy 674 0.00677653393118876
astrocytic glioma 2241 0.00917653311836324
diabetes mellitus 1663 0.016066528939152
ependymoma 2514 0.0166344667536078

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.400 0.009
ependymoma 1.400 0.017
oligodendroglioma 1.400 0.004
osteosarcoma -1.607 0.000
diabetes mellitus -1.100 0.016
Pick disease -2.500 0.000
progressive supranuclear palsy -1.900 0.007
ovarian cancer -2.300 0.000

Synonym

Accession Q86UT8
Symbols DLNB14

Gene

  Ortholog (9)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 Compartment GO Term (1)

AA Sequence

MAPAQRCPLCRQTFFCGRGHVYSRKHQRQLKEALERLLPQVEAARKAIRAAQVERYVPEHERCCWCLCCG      1 - 70
CEVREHLSHGNLTVLYGGLLEHLASPEHKKATNKFWWENKAEVQMKEKFLVTPQDYARFKKSMVKGLDSY     71 - 140
EEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPPA    141 - 210
PELDWMETGPSLTFIGHQDIPGVGNIHSGATPPWMIQDEEYIAGNQEIGPSYEEFLKEKEKQKLKKLPPD    211 - 280
RVGANFDHSSRTSAGWLPSFGRVWNNGRRWQSRHQFKTEAAAMKKQSHTEKS                      281 - 332
//

Text Mined References (4)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.