Property Summary

NCBI Gene PubMed Count 24
Grant Count 16
R01 Count 5
Funding $871,938.26
PubMed Score 77.77
PubTator Score 25.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma -1.300 0.018
psoriasis 2.000 0.000
osteosarcoma -1.010 0.000

 GO Function (1)

Gene RIF (19)

PMID Text
26763980 NLRX1, NLRP12 and NLRC3 negatively modulate the host immune response following virus exposure. (Review)
25938787 These data support a model in which CS-dependent NLRX1 inhibition facilitates MAVS/RHL activation and subsequent inflammation, remodeling, protease, cell death, and inflammasome responses.
25639646 NLRX1 acts as a potential tumor suppressor by regulating the TNF-alpha induced cell death and metabolism.
24429360 Together, these results suggest a novel mechanism for rhinovirus-induced epithelial barrier disruption involving NLRX-1 and mitochondrial reactive oxygen species generation.
23321557 NLRX1 and TUFM work in concert to reduce cytokine response and augment autophagy.
22749352 NLRX1 attenuated IFN-I production & promoted autophagy during viral infection cells. NLRX1 interacts with TUFM.
22718770 Post-transcriptional inhibition of luciferase reporter assays by the Nod-like receptor proteins NLRX1 and NLRC3.
22610944 Results showed that missense mutations in transmembrane protein 2 p.Ser1254Asn, interferon alpha 2 p.Ala120Thr, its regulator NLR family member X1 p.Arg707Cys, and complement component 2 p.Glu318Asp were associated with chronic hepatitis B.
22386589 NLRX1 interacts directly with RNA and suggestts a role for NLRX1 in recognition of intracellular viral RNA in antiviral immunity.
20959452 the presence of NLRX1 is required for optimal chlamydial growth and reactive oxygen species production
More...

AA Sequence

MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSAPPPGRHGRLF      1 - 70
PSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTPDELLRPPAELALEHQPPQAG     71 - 140
LPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMVLDWCYGRLPAFELLIPFSCEDLSSLGPAPA    141 - 210
SLCQLVAQRYTPLKEVLPLMAAAGSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYM    211 - 280
LPQASILVTTRPSAIGRIPSKYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHL    281 - 350
VQMLSRNLEGHHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS    351 - 420
LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAPCVEPGRAGTF    421 - 490
VFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIMAKLLPLRALPLLFNLIKVVP    491 - 560
RVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGL    561 - 630
LSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQ    631 - 700
LNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDL    701 - 770
RDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL    771 - 840
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSLTEGTAVSEYW    841 - 910
SVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS         911 - 975
//

Text Mined References (27)

PMID Year Title
26763980 2016 Beyond the inflammasome: regulatory NOD-like receptor modulation of the host immune response following virus exposure.
25938787 2015 Suppression of NLRX1 in chronic obstructive pulmonary disease.
25639646 2015 NLRX1 acts as tumor suppressor by regulating TNF-? induced apoptosis and metabolism in cancer cells.
24429360 2014 Nod-like receptor X-1 is required for rhinovirus-induced barrier dysfunction in airway epithelial cells.
23321557 2013 The NLR protein, NLRX1, and its partner, TUFM, reduce type I interferon, and enhance autophagy.
22749352 2012 The mitochondrial proteins NLRX1 and TUFM form a complex that regulates type I interferon and autophagy.
22718770 2012 Post-transcriptional inhibition of luciferase reporter assays by the Nod-like receptor proteins NLRX1 and NLRC3.
22610944 2012 Rare inborn errors associated with chronic hepatitis B virus infection.
22386589 2012 Structure and functional characterization of the RNA-binding element of the NLRX1 innate immune modulator.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
More...