Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $84,058.72
PubMed Score 6.10
PubTator Score 8.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.092 0.000
ulcerative colitis -1.600 0.000

Synonym

Accession Q86UT5 Q8N6R4 Q8NAW7 Q8NEX7 Q9H5Z3 NHERF-4
Symbols IKEPP
PDZK2
NHERF4

Gene

 Grant Application (2)

PDB

2V90  

Gene RIF (4)

PMID Text
22884631 IKEPP was also found to be expressed in vascular endothelial cells where it co-localizes and complexes with the hIP
22627094 The NHERF4 is a novel modulator of luminal fluidity in the intestine by adjusting SLC26A3 expression and activity through a phosphorylation-dependent mechanism.
19088451 Regulation of NHE3 depends on the nature of the NHERF family member associating with NHE3 and the accompanying NHE3 complexes.
11950846 A novel PDZ protein regulates the activity of guanylyl cyclase C, the heat-stable enterotoxin receptor.

AA Sequence

MVTPSPPGNHSLSLEAPRLHTASDLLGNHSLGLPLITALVGSRDRRGRVFSPVPVPLPTNPTTQHPTRQK      1 - 70
LPSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHV     71 - 140
VCRVDPGTSAQRQGLQEGDRILAVNNDVVEHEDYAVVVRRIRASSPRVLLTVLARHAHDVARAQLGEDAH    141 - 210
LCPTLGPGVRPRLCHIVKDEGGFGFSVTHGNQGPFWLVLSTGGAAERAGVPPGARLLEVNGVSVEKFTHN    211 - 280
QLTRKLWQSGQQVTLLVAGPEVEEQCRQLGLPLAAPLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLD    281 - 350
GRPGQFLWEVDPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMV    351 - 420
RLSPLLFLENTEAPASPRGSSSASLVETEDPSLEDTSVPSVPLGSRQCFLYPGPGGSYGFRLSCVASGPR    421 - 490
LFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDLERLQQLPEAEPPLCLKLAARSLRGLEAWIPPGA    491 - 560
AEDWALASDLL                                                               561 - 571
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22884631 2012 Interaction of the human prostacyclin receptor and the NHERF4 family member intestinal and kidney enriched PDZ protein (IKEPP).
22627094 2012 Regulation of SLC26A3 activity by NHERF4 PDZ-mediated interaction.
19088451 2008 Elevated intracellular calcium stimulates NHE3 activity by an IKEPP (NHERF4) dependent mechanism.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15523054 2005 PDZK1 directly regulates the function of organic cation/carnitine transporter OCTN2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615054 2003 C-terminal phosphorylation of MRP2 modulates its interaction with PDZ proteins.
More...