Property Summary

NCBI Gene PubMed Count 41
PubMed Score 31.83
PubTator Score 28.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q86US8 B7Z874 O94837 Q86VH6 Q9UF60
Symbols EST1A
SMG-6
C17orf31
hSMG5/7a

Gene

PDB

2DOK   2HWW   2HWX   4UM2  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (15)

PMID Text
25429978 A preferred sequence motif spanning most SMG6 cleavage sites has been discovered by analysis of endogenous non-sense-mediated mRNA decay targets.
25053839 SMG6 requires UPF1 and SMG1 for nonsense-mediated mRNA decay.
25013172 The study demonstrates that SMG5-SMG7 and SMG6 exhibit different and non-overlapping modes of UPF1 recognition, thus pointing at distinguished roles in integrating the complex nonsense-mediated mRNA decay interaction network.
24086375 Consistent with involvement of SMG6 in the decay process full-length nonsense-containing beta-globin mRNA was increased and the Delta169 decay intermediate was decreased in cells knocked down for SMG6.
22190034 HIV-1 PR is identified to have a physical interaction with smg-6 homolog, nonsense mediated mRNA decay factor (SMG6; EST1A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22011238 The tricotetrapeptide repeat-containing domain within Est1A was sufficient for interaction with hTERT.
20930030 Data show that SMG6 interacts directly with the EJC via two conserved EJC-binding motifs (EBMs).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLRNKPKIKEPPG      1 - 70
SEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDPENNRGQESFPRTAGQEDRSLKIIKRTKK     71 - 140
PDLQIYQPGRRLQTVSKESASRVEEEEVLNQVEQLRVEEDECRGNVAKEEVANKPDRAEIEKSPGGGRVG    141 - 210
AAKGEKGKRMGKGEGVRETHDDPARGRPGSAKRYSRSDKRRNRYRTRSTSSAGSNNSAEGAGLTDNGCRR    211 - 280
RRQDRTKERPRLKKQVSVSSTDSLDEDRIDEPDGLGPRRSSERKRHLERNWSGRGEGEQKNSAKEYRGTL    281 - 350
RVTFDAEAMNKESPMVRSARDDMDRGKPDKGLSSGGKGSEKQESKNPKQELRGRGRGILILPAHTTLSVN    351 - 420
SAGSPESAPLGPRLLFGSGSKGSRSWGRGGTTRRLWDPNNPDQKPALKTQTPQLHFLDTDDEVSPTSWGD    421 - 490
SRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYPGPYYPGYPTPSGQYVCSPLP    491 - 560
TSTMSPEEVEQHMRNLQQQELHRLLRVADNQELQLSNLLSRDRISPEGLEKMAQLRAELLQLYERCILLD    561 - 630
IEFSDNQNVDQILWKNAFYQVIEKFRQLVKDPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKL    631 - 700
EDYMDGLAIRSKPLRKTVKYALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYN    701 - 770
QLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKK    771 - 840
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGME    841 - 910
TFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVHNSQLKDCFSEECRSVIQEQAAALGLAMFS    911 - 980
LLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLDLP    981 - 1050
SHVAVDVWSTLADFCNILTAVNQSEVPLYKDPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSDKV   1051 - 1120
IAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGTRLEDEEEDVVIEDFEED   1121 - 1190
SEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLA   1191 - 1260
SLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTS   1261 - 1330
RGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKAL   1331 - 1400
TRNVPVRDIPAFLTWAQVG                                                      1401 - 1419
//

Text Mined References (48)

PMID Year Title
25429978 2015 Identification of SMG6 cleavage sites and a preferred RNA cleavage motif by global analysis of endogenous NMD targets in human cells.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25053839 2014 A novel phosphorylation-independent interaction between SMG6 and UPF1 is essential for human NMD.
25013172 2014 Phospho-dependent and phospho-independent interactions of the helicase UPF1 with the NMD factors SMG5-SMG7 and SMG6.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24086375 2013 SMG6 cleavage generates metastable decay intermediates from nonsense-containing ?-globin mRNA.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
More...