Property Summary

NCBI Gene PubMed Count 41
PubMed Score 85.73
PubTator Score 39.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
pancreatic cancer 2398 0.0 0.5
Disease Target Count
cone-rod dystrophy 59

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 9.5e-04
astrocytic glioma -3.300 1.2e-03
Astrocytoma, Pilocytic -1.800 2.7e-05
atypical teratoid / rhabdoid tumor -1.800 3.9e-08
ependymoma -1.400 1.3e-02
glioblastoma -2.000 2.6e-08
group 3 medulloblastoma -1.700 3.0e-02
head and neck cancer and chronic obstruc... -1.100 2.5e-02
medulloblastoma, large-cell -1.600 1.9e-04
oligodendroglioma -2.900 3.3e-03
Pick disease -1.400 1.7e-03
primitive neuroectodermal tumor -1.500 3.1e-03
psoriasis -1.400 3.7e-17
subependymal giant cell astrocytoma -1.972 4.6e-03

 OMIM Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MSSAVGPRGPRPPTVPPPMQELPDLSHLTEEERNIIMAVMDRQKEEEEKEEAMLKCVVRDMAKPAACKTP      1 - 70
RNAENQPHQPSPRLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFC     71 - 140
ARCGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQQTSQDGTLSDTATGAGSEVPREKKA    141 - 210
RLQERSRSQTPLSTAAASSQDAAPPSAPPDRSKGAEPSQQALGPEQKQASSRSRSEPPRERKKTPGLSEQ    211 - 280
NGKGALKSERKRVPKTSAQPVEGAVEERERKERRESRRLEKGRSQDYPDTPEKRDEGKAADEEKQRKEED    281 - 350
YQTRYRSDPNLARYPVKPPPEEQQMRMHARVSRARHERRHSDVALPRTEAGAALPEGKAGKRAPAAARAS    351 - 420
PPDSPRAYSAERTAETRAPGAKQLTNHSPPAPRHGPVPAEAPELKAQEPLRKQSRLDPSSAVLMRKAKRE    421 - 490
KVETMLRNDSLSSDQSESVRPSPPKPHRSKRGGKKRQMSVSSSEEEGVSTPEYTSCEDVELESESVSEKG    491 - 560
DLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGRVILNKRTTMPKDSGALLGLKVVGGKMTDLGR    561 - 630
LGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPRIP    631 - 700
ESSHPPLESSSSSFESQKMERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLP    701 - 770
ARVDGRPRNPYVKMYFLPDRSDKSKRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQE    771 - 840
EESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQRSQRISDSDIS    841 - 910
DYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDE    911 - 980
IHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTRHLVRHYKTLPP    981 - 1050
KMPLLQSSSHWNIYSSILPAHTKTKSVTRQDISLHHECFNSTVLRFTDEILVSELQPFLDRARSASTNCL   1051 - 1120
RPDTSLHSPERERGRWSPSLDRRRPPSPRIQIQHASPENDRHSRKSERSSIQKQTRKGTASDAERVLPTC   1121 - 1190
LSRRGHAAPRATDQPVIRGKHPARSRSSEHSSIRTLCSMHHLVPGGSAPPSPLLTRMHRQRSPTQSPPAD   1191 - 1260
TSFSSRRGRQLPQVPVRSGSIEQASLVVEERTRQMKMKVHRFKQTTGSGSSQELDREQYSKYNIHKDQYR   1261 - 1330
SCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSFTPKMQGRRMGTSGRSIMKSTS   1331 - 1400
VSGEMYTLEHNDGSQSDTAVGTVGAGGKKRRSSLSAKVVAIVSRRSRSTSQLSQTESGHKKLKSTIQRST   1401 - 1470
ETGMAAEMRKMVRQPSRESTDGSINSYSSEGNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMG   1471 - 1540
DIQIGMEDKKGQLEVEVIRARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLVF   1541 - 1610
DESPQGKVLQVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQSS   1611 - 1680
LESSTGPPCIRS                                                             1681 - 1692
//

Text Mined References (45)

PMID Year Title