Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.95
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.200 5.3e-04
atypical teratoid / rhabdoid tumor -1.100 2.2e-05
glioblastoma -1.400 4.1e-06
lung adenocarcinoma 1.300 1.5e-07
medulloblastoma, large-cell -1.600 2.2e-05
non primary Sjogren syndrome sicca 1.300 2.0e-02

Gene RIF (13)

AA Sequence

MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTC      1 - 70
MAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTE     71 - 140
AASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAI    141 - 210
PDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAP    211 - 280
LSPGLPAMGGPGPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ    281 - 350
LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF    351 - 420
RQGDTVDVLCEVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP                  421 - 476
//

Text Mined References (33)

PMID Year Title