Property Summary

NCBI Gene PubMed Count 24
Grant Count 15
R01 Count 15
Funding $693,053.78
PubMed Score 16.12
PubTator Score 18.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (12)

PMID Text
24187133 A NOXA1 peptide blocked NOXA1-Nox1 binding. The finding identifies a NOXA1-activating domain and an isoform-specific Nox1 inhibitor.
23957209 Phosphorylation of Thr341 allows Noxo1 to sufficiently interact with Noxa1, an interaction that participates in Nox1 activation
22244833 Noxa1 has quite different kinetic properties from p67(phox) and suggest that Noxa1 may function as a moderate activator of Nox2.
20943948 The Nox1-dependent generation of reactive oxygen species is dependent on Src phosphorylation of NoxA1 and Tks4. Blockage of phosphorylation of NoxA1 and Tks4 decreases Nox1-dependent ROS generation and blocks SrcYF-induced invadopodia formation.
20609497 Tks4 and Tks5 directly bind to NoxA1. The integrity of the N-terminal PRR of NoxA1 is essential for this direct interaction with the Tks proteins.
20454568 The first quantitative characterization of the interactions made between the cytosolic regulators NOXO1 and NOXA1 and membrane-bound p22(phox), is presented.
20230789 these results demonstrate that phosphorylation of NoxA1 is a part of the feedback mechanism that functions through activation of Rac with a net outcome of negative modulation of Nox1 activity.
20083677 NoxA1 is the functional homolog of p67phox in vascular smooth muscle cells (VSMC) that regulates redox signaling and VSMC phenotype.
18606821 a novel, inhibitory function for Noxa1 in Duox1 regulation.
18568954 Essential role of NOXA1 in generation of reacgtive oxygen species induced by oxidized low density lipoprotein in endothelial cells is reported.
More...

AA Sequence

MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRAFDQAVTKDTC      1 - 70
MAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQAWEVLHNVASAQCQLGLWTE     71 - 140
AASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAI    141 - 210
PDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAP    211 - 280
LSPGLPAMGGPGPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQ    281 - 350
LGQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYSAQGPEDLGF    351 - 420
RQGDTVDVLCEVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAPGRLPRSQQGDQP                  421 - 476
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24187133 2013 Selective recapitulation of conserved and nonconserved regions of putative NOXA1 protein activation domain confers isoform-specific inhibition of Nox1 oxidase and attenuation of endothelial cell migration.
23957209 2013 Phosphorylation of Noxo1 at threonine 341 regulates its interaction with Noxa1 and the superoxide-producing activity of Nox1.
22244833 2012 Noxa1 as a moderate activator of Nox2-based NADPH oxidase.
20943948 2010 c-Src-mediated phosphorylation of NoxA1 and Tks4 induces the reactive oxygen species (ROS)-dependent formation of functional invadopodia in human colon cancer cells.
20609497 Direct interaction between Tks proteins and the N-terminal proline-rich region (PRR) of NoxA1 mediates Nox1-dependent ROS generation.
20454568 2010 Regulation of NOXO1 activity through reversible interactions with p22 and NOXA1.
20230789 2010 Phosphorylation of serine282 in NADPH oxidase activator 1 by Erk desensitizes EGF-induced ROS generation.
20083677 2010 Nox activator 1: a potential target for modulation of vascular reactive oxygen species in atherosclerotic arteries.
19755710 2009 Novel p47(phox)-related organizers regulate localized NADPH oxidase 1 (Nox1) activity.
More...