Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hemoglobinopathy 2 3.734 1.9
osteosarcoma 7,933

Gene RIF (3)

PMID Text
15273251 stabilization of NF-E4 by acetylation is PCAF-dependent; acetylation of Lys(43) also reduces the interaction between NF-E4 and HDAC1, potentially maximizing the activating ability of the factor
15084587 findings indicate that p22 NF-E4 is capable of influencing human globin gene expression in vivo but is incapable of overriding the intrinsic mechanisms governing gamma-gene silencing in this context
11003662 Cloning and characterization of NF-E4 as a component of the stage selector protein complex, and demonstration of non-AUG translation initiation codon usage.

AA Sequence

MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLT      1 - 70
YWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPH     71 - 140
PFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG                                   141 - 179
//

Text Mined References (5)

PMID Year Title
16263792 2006 Repression of human gamma-globin gene expression by a short isoform of the NF-E4 protein is associated with loss of NF-E2 and RNA polymerase II recruitment to the promoter.
15273251 2004 Site-specific acetylation of the fetal globin activator NF-E4 prevents its ubiquitination and regulates its interaction with the histone deacetylase, HDAC1.
15084587 2004 The role of p22 NF-E4 in human globin gene switching.
12853948 2003 The DNA sequence of human chromosome 7.
11003662 2000 Induction of human fetal globin gene expression by a novel erythroid factor, NF-E4.