Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.5e-05
Disease Target Count Z-score Confidence
Hemoglobinopathy 1 3.196 1.6

Gene RIF (3)

AA Sequence

MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLT      1 - 70
YWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPH     71 - 140
PFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG                                   141 - 179
//

Text Mined References (5)

PMID Year Title