Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.500 0.000

AA Sequence

MQSDIYHPGHSFPSWVLCWVHSCGHEGHLRETAEIRKTHQNGDLQIRGGRGRRESTEIFQVASVTEGEES      1 - 70
PPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSEERQIRIERHHYHLYGQ         71 - 136
//

Text Mined References (2)

PMID Year Title
16177791 2005 DNA sequence and analysis of human chromosome 18.
12682296 2003 Epigenetic abnormalities associated with a chromosome 18(q21-q22) inversion and a Gilles de la Tourette syndrome phenotype.