Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.4e-06

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.500 6.4e-06

AA Sequence

MQSDIYHPGHSFPSWVLCWVHSCGHEGHLRETAEIRKTHQNGDLQIRGGRGRRESTEIFQVASVTEGEES      1 - 70
PPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSEERQIRIERHHYHLYGQ         71 - 136
//

Text Mined References (2)

PMID Year Title