Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.94
PubTator Score 1.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 2.300 0.031
astrocytoma 1.400 0.000
glioblastoma 1.900 0.003
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -2.800 0.000
adult high grade glioma 1.600 0.020
pilocytic astrocytoma 3.500 0.000
Endometriosis -1.549 0.037
ovarian cancer -2.100 0.000

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MPGAAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA      1 - 70
GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI     71 - 140
CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL    141 - 210
GNRQDSLMAEELKAENKVLLSQYSLE                                                211 - 236
//

Text Mined References (13)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...