Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.94
PubTator Score 1.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pilocytic astrocytoma 3086 2.63657244973755E-11
ovarian cancer 8492 1.74441491585841E-8
atypical teratoid / rhabdoid tumor 4369 2.00675030841832E-7
group 4 medulloblastoma 1875 7.69309370170219E-5
astrocytoma 1493 1.14022830498288E-4
medulloblastoma, large-cell 6234 1.70572463496643E-4
glioblastoma 5572 0.00337479816689377
adult high grade glioma 2148 0.0197529102150166
oligodendroglioma 2849 0.0309124791475139
Endometriosis 535 0.0368766066173366
Disease Target Count Z-score Confidence
Obesity 616 0.0 1.0
Disease Target Count Z-score Confidence
Smooth muscle tumor 12 3.97 2.0

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 2.300 0.031
astrocytoma 1.400 0.000
glioblastoma 1.900 0.003
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -2.800 0.000
adult high grade glioma 1.600 0.020
pilocytic astrocytoma 3.500 0.000
Endometriosis -1.549 0.037
ovarian cancer -2.100 0.000

Synonym

Accession Q86UP9 A1L383 A4D0Q5
Symbols LHFPL4

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MPGAAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA      1 - 70
GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI     71 - 140
CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL    141 - 210
GNRQDSLMAEELKAENKVLLSQYSLE                                                211 - 236
//

Text Mined References (13)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...