Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.31
PubTator Score 1.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.600 2.0e-02
astrocytoma 1.400 1.1e-04
Astrocytoma, Pilocytic 3.500 4.2e-11
atypical teratoid / rhabdoid tumor -3.300 2.0e-07
Endometriosis -1.549 3.7e-02
glioblastoma 1.900 3.4e-03
group 4 medulloblastoma -2.100 7.7e-05
medulloblastoma, large-cell -2.800 1.7e-04
oligodendroglioma 2.300 3.1e-02
ovarian cancer -2.100 1.7e-08

Synonym

Accession Q86UP9 A1L383 A4D0Q5
Symbols LHFPL4

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (3)

AA Sequence

MPGAAAAAAAAAAAMLPAQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA      1 - 70
GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI     71 - 140
CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL    141 - 210
GNRQDSLMAEELKAENKVLLSQYSLE                                                211 - 236
//

Text Mined References (13)

PMID Year Title