Property Summary

NCBI Gene PubMed Count 40
Grant Count 9
R01 Count 5
Funding $347,443.67
PubMed Score 78.99
PubTator Score 45.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.021
Waldenstrons macroglobulinemia 1.264 0.025
osteosarcoma 2.873 0.000
lung cancer 1.200 0.002
subependymal giant cell astrocytoma 1.333 0.036
Pick disease 1.600 0.000
progressive supranuclear palsy -1.200 0.012
acute myeloid leukemia 1.100 0.040
ovarian cancer 2.100 0.000

Gene RIF (12)

PMID Text
22679391 Kinectin may have the ability to anchor mRNAs to the surface of the endoplasmic reticulum.
22184201 The kinesin-1 deficiency weakened intercellular adhesion, despite the maintenance of adherens junctions and other desmosome components at the plasma membrane.
21305317 The genes identified KTN1, ROCK1, and ZAK may be responsible for loss of cellular homeostasis in giant cells tumors of bone
21111237 Kinectin is concentrated in the perinuclear sheets of the endoplasmic reticulum by interacting with polysomes. Kinectin may play a role in determinining the morphology of the endoplasmic reticulum.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19472918 A large number of variations were found in many of the genes (myozenin 1, gamma-filamin, kinectin-1) in patients with limb-girdle muscular dystrophies and controls.
19472918 Observational study of gene-disease association. (HuGE Navigator)
17013387 When kinesin binds with both heads to the microtubule, the neck linkers in the rear and forward heads extend forward and backward. This supports the notion that neck linker movements accompany the 'hand-over-hand' motion of the two motor domains.
16950774 anchoring the elongation factor-1 complex onto endoplasmic reticulum via EF-1delta/kinectin interaction is important for regulating protein synthesis in eukaryotic cells
16890462 The data suggests that both KNT and KNTvd4(-) participate in microtubule-dependent secretion of amylin in islet beta-cells.
More...

AA Sequence

MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNG      1 - 70
NLHESDSESVPRDFKLSDALAVEDDQVAPVPLNVVETSSSVRERKKKEKKQKPVLEEQVIKESDASKIPG     71 - 140
KKVEPVPVTKQPTPPSEAAASKKKPGQKKSKNGSDDQDKKVETLMVPSKRQEALPLHQETKQESGSGKKK    141 - 210
ASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENA    211 - 280
EVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQDALKKSSKGELTTLIHQLQEKDKLLAAVKEDAAA    281 - 350
TKDRCKQLTQEMMTEKERSNVVITRMKDRIGTLEKEHNVFQNKIHVSYQETQQMQMKFQQVREQMEAEIA    351 - 420
HLKQENGILRDAVSNTTNQLESKQSAELNKLRQDYARLVNELTEKTGKLQQEEVQKKNAEQAATQLKVQL    421 - 490
QEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLTDTLVSKQQLEQRLMQLMESEQKR    491 - 560
VNKEESLQMQVQDILEQNEALKAQIQQFHSQIAAQTSASVLAEELHKVIAEKDKQIKQTEDSLASERDRL    561 - 630
TSKEEELKDIQNMNFLLKAEVQKLQALANEQAAAAHELEKMQQSVYVKDDKIRLLEEQLQHEISNKMEEF    631 - 700
KILNDQNKALKSEVQKLQTLVSEQPNKDVVEQMEKCIQEKDEKLKTVEELLETGLIQVATKEEELNAIRT    701 - 770
ENSSLTKEVQDLKAKQNDQVSFASLVEELKKVIHEKDGKIKSVEELLEAELLKVANKEKTVQDLKQEIKA    771 - 840
LKEEIGNVQLEKAQQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDLQEENESLKAH    841 - 910
VQEVAQHNLKEASSASQFEELEIVLKEKENELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQL    911 - 980
KQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALASTEKML    981 - 1050
QDKVNKTSKERQQQVEAVELEAKEVLKKLFPKVSVPSNLSYGEWLHGFEKKAKECMAGTSGSEEVKVLEH   1051 - 1120
KLKEADEMHTLLQLECEKYKSVLAETEGILQKLQRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELE   1121 - 1190
RLRSENKDIENLRREREHLEMELEKAEMERSTYVTEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKA   1191 - 1260
QLNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAAGDTTVIENSDVSPETESSEKETMSVSLNQ   1261 - 1330
TVTQLQQLLQAVNQQLTKEKEHYQVLE                                              1331 - 1357
//

Text Mined References (50)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679391 2012 p180 promotes the ribosome-independent localization of a subset of mRNA to the endoplasmic reticulum.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22184201 2011 Desmosomal cadherins utilize distinct kinesins for assembly into desmosomes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...