Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.89
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Accession Q86UP0 D3DS44 Q86UP1 Q9NT84
Symbols CDH11L

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24898286 Unconventional CDH10, CDH24 and DCHS2 genes harbored frameshift mutations.
12734196 cadherin-24 is a novel alternatively spliced type II cadherin

AA Sequence

MWGLVRLLLAWLGGWGCMGRLAAPARAWAGSREHPGPALLRTRRSWVWNQFFVIEEYAGPEPVLIGKLHS      1 - 70
DVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQAVDRASNRPLEPPSEFIIKV     71 - 140
QDINDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDGLPFFSVDPQTGVVRT    141 - 210
AIPNMDRETQEEFLVVIQAKDMGGHMGGLSGSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAGPGTLVGR    211 - 280
LRAQDPDLGDNALMAYSILDGEGSEAFSISTDLQGRDGLLTVRKPLDFESQRSYSFRVEATNTLIDPAYL    281 - 350
RRGPFKDVASVRVAVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSILPHSDPER    351 - 420
CFSIQPEEGTIHTAAPLDREARAWHNLTVLATELGWSWGPERGWVPLLVAEWSAPAAPPQRSPVGSAVGI    421 - 490
PQDSSAQASRVQVAIQTLDENDNAPQLAEPYDTFVCDSAAPGQLIQVIRALDRDEVGNSSHVSFQGPLGP    491 - 560
DANFTVQDNRDGSASLLLPSRPAPPRHAPYLVPIELWDWGQPALSSTATVTVSVCRCQPDGSVASCWPEA    561 - 630
HLSAAGLSTGALLAIITCVGALLALVVLFVALRRQKQEALMVLEEEDVRENIITYDDEGGGEEDTEAFDI    631 - 700
TALQNPDGAAPPAPGPPARRDVLPRARVSRQPRPPGPADVAQLLALRLREADEDPGVPPYDSVQVYGYEG    701 - 770
RGSSCGSLSSLGSGSEAGGAPGPAEPLDDWGPLFRTLAELYGAKEPPAP                         771 - 819
//

Text Mined References (6)

PMID Year Title
24898286 2015 Frameshift mutations of cadherin genes DCHS2, CDH10 and CDH24 genes in gastric and colorectal cancers with high microsatellite instability.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12734196 2003 Characterization of cadherin-24, a novel alternatively spliced type II cadherin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.