Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 5.700 0.000
nasopharyngeal carcinoma -3.400 0.000
Endometriosis -1.588 0.006
psoriasis -1.300 0.012

Gene RIF (1)

PMID Text
12475942 AKAP28 likely plays a role in the signaling necessary for efficient modulation of ciliary beat frequency

AA Sequence

MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIVEEERNPLKNIKWMTH      1 - 70
GEFTVEKGLKQIDEYFSKCVSKKCWAHGVEFVERKDLIHSFLYIYYVHWSISTADLPVARISAGTYFTMK     71 - 140
VSKTKPPDAPIVVSYVGDHQALVHRPGMVRFRENWQKNLTDAKYSFMESFPFLFNRV                 141 - 197
//

Text Mined References (5)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475942 2002 Characterization of an A-kinase anchoring protein in human ciliary axonemes.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.