Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
Funding $216,344.02
PubMed Score 14.64
PubTator Score 9.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma -1.600 0.000
glioblastoma multiforme -1.700 0.000
oligodendroglioma -1.400 0.000
medulloblastoma, large-cell 2.000 0.001
lung adenocarcinoma 2.200 0.000

Gene RIF (5)

PMID Text
24956133 Authors highlight the structural and biochemical aspects of the interaction of Nogo receptors (R1 and R2) with myelin inhibitors such as MAG, Nogo A and OMgp.[Review]
21906273 These results indicate that a lack of NgR1/2 expression promotes the adhesion of DCs to myelin.
18337405 Nogo-66 receptor homolog 1 signaling regulates activity-dependent synaptic strength and neuronal plasticity.
15629437 The release of N-terminal fragment-NgRH1 was blocked by a hydroxamate-based zinc metalloproteinase inhibitor and tissue inhibitor of metalloproteinases-2 and -3
14664809 predominantly expressed in the neurons of the embryonic and adult nervous systems

AA Sequence

MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNN      1 - 70
LIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYR     71 - 140
CQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLL    141 - 210
HGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRAR    211 - 280
VSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRD    281 - 350
LPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL    351 - 420
//

Text Mined References (13)

PMID Year Title
24956133 2014 Structural features of the Nogo receptor signaling complexes at the neuron/myelin interface.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21906273 2011 Nogo receptor is involved in the adhesion of dendritic cells to myelin.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
18337405 2008 Synaptic function for the Nogo-66 receptor NgR1: regulation of dendritic spine morphology and activity-dependent synaptic strength.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15629437 2005 Ectodomain shedding of human Nogo-66 receptor homologue-1 by zinc metalloproteinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14664809 2003 Two novel mammalian Nogo receptor homologs differentially expressed in the central and peripheral nervous systems.
More...