Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.45
PubTator Score 9.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma -1.600 3.7e-24
glioblastoma multiforme -1.700 1.1e-29
lung adenocarcinoma 2.200 1.2e-07
medulloblastoma, large-cell 2.000 7.4e-04
oligodendroglioma -1.400 1.9e-14

Gene RIF (5)

AA Sequence

MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNN      1 - 70
LIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYR     71 - 140
CQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLL    141 - 210
HGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRAR    211 - 280
VSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRD    281 - 350
LPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL    351 - 420
//

Text Mined References (14)

PMID Year Title