Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $141,421.68
PubMed Score 5.66
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.000 0.002
ependymoma -2.400 0.000
oligodendroglioma -1.700 0.007
glioblastoma -2.900 0.000
osteosarcoma -1.123 0.002
group 4 medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -2.200 0.001
adult high grade glioma -2.900 0.000
pilocytic astrocytoma -2.400 0.000
lung carcinoma 1.100 0.000
psoriasis -1.400 0.000

Synonym

Accession Q86UN2 A1A5E3 Q8ND46
Symbols NgR3
NGRH2

Gene

Gene RIF (3)

PMID Text
26383923 Duplication of 10q22.3-q23.3 encompassing NGR3 gene is associated with congenital heart disease, microcephaly, and mild intellectual disability
22133682 Nogo receptor 3, a paralog of NgR1,functions as a NgR1 co-receptor for Nogo-66.
14664809 predominantly expressed in the neurons of the embryonic and adult nervous systems

AA Sequence

MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQ      1 - 70
PGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSAL     71 - 140
PAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQ    141 - 210
WVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAV    211 - 280
PCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHR    281 - 350
KPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS    351 - 420
SASSLGASLLAWTLGLAVTLR                                                     421 - 441
//

Text Mined References (12)

PMID Year Title
26383923 2015 Duplication of 10q22.3-q23.3 encompassing BMPR1A and NGR3 associated with congenital heart disease, microcephaly, and mild intellectual disability.
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22133682 2011 Nogo receptor 3, a paralog of Nogo-66 receptor 1 (NgR1), may function as a NgR1 co-receptor for Nogo-66.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14664809 2003 Two novel mammalian Nogo receptor homologs differentially expressed in the central and peripheral nervous systems.
12839991 2003 Structure and axon outgrowth inhibitor binding of the Nogo-66 receptor and related proteins.
12694398 2003 Characterization of two novel proteins, NgRH1 and NgRH2, structurally and biochemically homologous to the Nogo-66 receptor.
More...