Property Summary

NCBI Gene PubMed Count 10
Grant Count 1,250
R01 Count 776
Funding $153,016,820.07
PubMed Score 14.92
PubTator Score 3.89

Knowledge Summary

Patent

No data available

Synonym

Accession Q86UG4 A6NHC1 Q6ZMY5 Q86UV2 Q8IYU5
Symbols GST
CT48
OATPY
OATP-I
OATP6A1

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
26861727 No association of gene SLCO6A1 rs6878284 with schizophrenia; rs7734060 could be a risk locus for major depressive disorder in the Han Chinese population
25301452 High OATP6A1 expression is associated with small cell lung cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19397531 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MFVGVARHSGSQDEVSRGVEPLEAARAQPAKDRRAKGTPKSSKPGKKHRYLRLLPEALIRFGGFRKRKKA      1 - 70
KSSVSKKPGEVDDSLEQPCGLGCLVSTCCECCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLK     71 - 140
TIEKLALEKSYDISSGLVAIFIAFYGDRKKVIWFVASSFLIGLGSLLCAFPSINEENKQSKVGIEDICEE    141 - 210
IKVVSGCQSSGISFQSKYLSFFILGQTVQGIAGMPLYILGITFIDENVATHSAGIYLGIAECTSMIGYAL    211 - 280
GYVLGAPLVKVPENTTSATNTTVNNGSPEWLWTWWINFLFAAVVAWCTLIPLSCFPNNMPGSTRIKARKR    281 - 350
KQLHFFDSRLKDLKLGTNIKDLCAALWILMKNPVLICLALSKATEYLVIIGASEFLPIYLENQFILTPTV    351 - 420
ATTLAGLVLIPGGALGQLLGGVIVSTLEMSCKALMRFIMVTSVISLILLVFIIFVRCNPVQFAGINEDYD    421 - 490
GTGKLGNLTAPCNEKCRCSSSIYSSICGRDDIEYFSPCFAGCTYSKAQNQKKMYYNCSCIKEGLITADAE    491 - 560
GDFIDARPGKCDAKCYKLPLFIAFIFSTLIFSGFSGVPIVLAMTRVVPDKLRSLALGVSYVILRIFGTIP    561 - 630
GPSIFKMSGETSCILRDVNKCGHTGRCWIYNKTKMAFLLVGICFLCKLCTIIFTTIAFFIYKRRLNENTD    631 - 700
FPDVTVKNPKVKKKEETDL                                                       701 - 719
//

Text Mined References (14)

PMID Year Title
26861727 2016 Analysis of association between common variants in the SLCO6A1 gene with schizophrenia, bipolar disorder and major depressive disorder in the Han Chinese population.
25301452 2015 Specific expression of OATPs in primary small cell lung cancer (SCLC) cells as novel biomarkers for diagnosis and therapy.
24468470 2014 Genetic susceptibility to accelerated cognitive decline in the US Health and Retirement Study.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19571808 2009 Common variants conferring risk of schizophrenia.
19397531 2009 Genetic polymorphisms in Thai neonates with hyperbilirubinemia.
15546177 2004 Identification of the gonad-specific anion transporter SLCO6A1 as a cancer/testis (CT) antigen expressed in human lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...