Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.35
PubTator Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 2.3e-05
cystic fibrosis 1696 4.8e-05
nasopharyngeal carcinoma 1058 7.1e-05
lung carcinoma 2843 3.9e-03
chronic rhinosinusitis 512 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cannabis dependence 23 5.243 2.6

Expression

  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.975 4.4e-02
cystic fibrosis -1.778 4.8e-05
ependymoma 1.900 2.3e-05
lung carcinoma -1.200 3.9e-03
nasopharyngeal carcinoma -2.400 7.1e-05

Gene RIF (2)

AA Sequence

MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKF      1 - 70
SSYLGNGFQKRPEDVLVFSPQGRQKHRAPQAKKMRALATRMAQDTCKSKSQVPPSHDAGLKDPMKSKKQP     71 - 140
LSQNNRTACFIKEQPQAQEKDSVNPSKDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETR    141 - 210
SKDVALKPDGNTGKQIPPKHMECAGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHG    211 - 280
ESSSSRAGKECENRVPSKFLPL                                                    281 - 302
//

Text Mined References (7)

PMID Year Title