Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.35
PubTator Score 0.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 3.000 0.000
cystic fibrosis -1.778 0.000
nasopharyngeal carcinoma -2.400 0.000
lung carcinoma -1.200 0.004
chronic rhinosinusitis -1.975 0.044

Synonym

Accession Q86UF4 Q5JSG1 Q6ZW57
Symbols C1orf110

Gene

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20664687 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERHMVRGQLYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKF      1 - 70
SSYLGNGFQKRPEDVLVFSPQGRQKHRAPQAKKMRALATRMAQDTCKSKSQVPPSHDAGLKDPMKSKKQP     71 - 140
LSQNNRTACFIKEQPQAQEKDSVNPSKDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETR    141 - 210
SKDVALKPDGNTGKQIPPKHMECAGSFEGEFTKPTFLELLSKARNAHYLRHRVPPESERLLSIGEIFGHG    211 - 280
ESSSSRAGKECENRVPSKFLPL                                                    281 - 302
//

Text Mined References (7)

PMID Year Title
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
20664687 2010 Single-nucleotide polymorphisms in chromosome 3p14.1- 3p14.2 are associated with susceptibility of type 2 diabetes with cataract.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.