Property Summary

NCBI Gene PubMed Count 18
Grant Count 2
Funding $25,550
PubMed Score 9.33
PubTator Score 8.93

Knowledge Summary

Patent (1,607)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.414 0.000

Synonym

Accession Q86UE8 D3DU07 Q9UKI7 Q9Y4F7
Symbols HsHPK
PKU-ALPHA

Gene

 Grant Application (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
23414760 TLK2 plays a role in Kaposi's sarcoma-associated herpesvirus reactivation.
21647934 TLKs appear to be intimately linked to the pattern of resistance to DNA damage, and specifically double-strand breaks.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
18976975 Knockdown of tousled-like kinase 2 (TLK2) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MMEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPY      1 - 70
ETSQGKGTPRGHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPRRVEQPLYGLDGSAAKEAT     71 - 140
EEQSALPTLMSVMLAKPRLDTEQLAQRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQS    141 - 210
DLTIEKISALENSKNSDLEKKEGRIDDLLRANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQ    211 - 280
EKMACRDKSMQDRLRLGHFTTVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAM    281 - 350
GQAPPATNEQKQRKSKTNGAENETPSSGNTELKDTAPALGAHSLLRLTLAEYHEQEEIFKLRLGHLKKEE    351 - 420
AEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEVYKAFDLTEQRYVAV    421 - 490
KIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHK    491 - 560
LMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNILLVNGTACGEIKITDFGLSKIMDDDSYNSVDG    561 - 630
MELTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENTILKAT    631 - 700
EVQFPPKPVVTPEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSPAGAAIASTSGASNNSS    701 - 770
SN                                                                        771 - 772
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414760 2013 Tousled-like kinases modulate reactivation of gammaherpesviruses from latency.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21647934 2011 The expression of Tousled kinases in CaP cell lines and its relation to radiation response and DSB repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20705056 2010 Caenorhabditis elegans TLK-1 controls cytokinesis by localizing AIR-2/Aurora B to midzone microtubules.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...