Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.33
PubTator Score 8.93

Knowledge Summary

Patent (1,607)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.74203269062222E-9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.414 0.000

Synonym

Accession Q86UE8 D3DU07 Q9UKI7 Q9Y4F7
Symbols HsHPK
PKU-ALPHA

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
23414760 TLK2 plays a role in Kaposi's sarcoma-associated herpesvirus reactivation.
21647934 TLKs appear to be intimately linked to the pattern of resistance to DNA damage, and specifically double-strand breaks.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
18976975 Knockdown of tousled-like kinase 2 (TLK2) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MMEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPY      1 - 70
ETSQGKGTPRGHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPRRVEQPLYGLDGSAAKEAT     71 - 140
EEQSALPTLMSVMLAKPRLDTEQLAQRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQS    141 - 210
DLTIEKISALENSKNSDLEKKEGRIDDLLRANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQ    211 - 280
EKMACRDKSMQDRLRLGHFTTVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAM    281 - 350
GQAPPATNEQKQRKSKTNGAENETPSSGNTELKDTAPALGAHSLLRLTLAEYHEQEEIFKLRLGHLKKEE    351 - 420
AEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEVYKAFDLTEQRYVAV    421 - 490
KIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHK    491 - 560
LMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNILLVNGTACGEIKITDFGLSKIMDDDSYNSVDG    561 - 630
MELTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENTILKAT    631 - 700
EVQFPPKPVVTPEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSPAGAAIASTSGASNNSS    701 - 770
SN                                                                        771 - 772
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23414760 2013 Tousled-like kinases modulate reactivation of gammaherpesviruses from latency.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21647934 2011 The expression of Tousled kinases in CaP cell lines and its relation to radiation response and DSB repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20705056 2010 Caenorhabditis elegans TLK-1 controls cytokinesis by localizing AIR-2/Aurora B to midzone microtubules.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...