Tbio | Leucine-rich repeat transmembrane neuronal protein 1 |
Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation, acting at both pre- and postsynaptic level.
Comments
Disease | Target Count | P-value |
---|---|---|
medulloblastoma | 1524 | 5.66756604156125E-7 |
atypical teratoid / rhabdoid tumor | 4369 | 3.18674064417702E-5 |
posterior fossa group A ependymoma | 1511 | 1.94719908775539E-4 |
glioblastoma | 5572 | 3.51493193248074E-4 |
medulloblastoma, large-cell | 6234 | 9.17850252746846E-4 |
adult high grade glioma | 2148 | 9.56883628206703E-4 |
astrocytic glioma | 2241 | 0.00570884084583584 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Schizophrenia | 503 | 4.309 | 2.2 |
Choanal atresia | 19 | 3.325 | 1.7 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.300 | 0.006 |
posterior fossa group A ependymoma | -1.500 | 0.000 |
glioblastoma | -2.200 | 0.000 |
medulloblastoma | -2.900 | 0.000 |
atypical teratoid / rhabdoid tumor | -2.600 | 0.000 |
medulloblastoma, large-cell | -2.800 | 0.001 |
adult high grade glioma | -2.200 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
25111784 | Hypomethylation of the paternally inherited LRRTM1 promoter is linked to schizophrenia. |
24785688 | Continuity between schizophrenia and schizotypy exists with regard to the psychological effects of allelic variation in LRRTM1, and epigenetic variation in the imprinted gene mediates the development and expression of human handedness. |
21708131 | CTNNA1 and CTNNA2 contain alternative 5' exons linked to bidirectional promoters that are shared with the antisense oriented LRRTM2 and LRRTM1 genes, respectively. |
21041608 | 16 SNPs in 12 genes showed significant interaction at P < .05, 3 of which survived correction for multiple testing (P < .0003), situated in AKT1 (rs2494732 and rs1130233) and LRRTM1 (rs673871). |
21041608 | Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) |
20678249 | Observational study of gene-disease association. (HuGE Navigator) |
19626025 | Results strengthen the evidence for an association of imprinted alleles of LRRTM1 with schizophrenia. Weaker supportive evidence was also obtained for a possible association of LRTTM1 with human brain asymmetry. |
19125367 | Recent study in which the first putative genetic effect on human handedness was identified (the imprinted locus LRRTM1 on human chromosome 2). |
19125366 | While we agree (and indeed first proposed) that the variation underlying psychosis is intrinsically related to the cerebral torque, which we take to be the anatomical basis of language, we are unconvinced by the data for LRRTM1. |
19125365 | Whether or not LRRTM1 on chromosome 2p12 is indeed the genetic basis of handedness is still unclear, although the controversy of the claim seems indisputable. |
More... |
MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGL 1 - 70 SLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLR 71 - 140 SVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFK 141 - 210 LTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVP 211 - 280 HLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQG 281 - 350 EDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE 351 - 420 NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYV 421 - 490 DYKPNHIEGALVIINEYGSCTCHQQPARECEV 491 - 522 //
PMID | Year | Title |
---|---|---|
25111784 | 2014 | Hypomethylation of the paternally inherited LRRTM1 promoter linked to schizophrenia. |
24785688 | 2014 | The imprinted gene LRRTM1 mediates schizotypy and handedness in a nonclinical population. |
21708131 | 2011 | Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms. |
21041608 | 2011 | Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up. |
20678249 | 2010 | Polymorphisms in leucine-rich repeat genes are associated with autism spectrum disorder susceptibility in populations of European ancestry. |
19626025 | 2009 | Supporting evidence for LRRTM1 imprinting effects in schizophrenia. |
19125367 | 2009 | Understanding the genetics of behavioural and psychiatric traits will only be achieved through a realistic assessment of their complexity. |
19125366 | 2009 | Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007). |
19125365 | 2009 | Editorial commentary: is LRRTM1 the gene for handedness? |
17667961 | 2007 | LRRTM1 on chromosome 2p12 is a maternally suppressed gene that is associated paternally with handedness and schizophrenia. |
More... |