Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.32
PubTator Score 14.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 0.006
posterior fossa group A ependymoma -1.500 0.000
glioblastoma -2.200 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.800 0.001
adult high grade glioma -2.200 0.001

Synonym

Accession Q86UE6 A8K397 D6W5K1 Q96DN1
Symbols

Gene

Gene RIF (11)

PMID Text
25111784 Hypomethylation of the paternally inherited LRRTM1 promoter is linked to schizophrenia.
24785688 Continuity between schizophrenia and schizotypy exists with regard to the psychological effects of allelic variation in LRRTM1, and epigenetic variation in the imprinted gene mediates the development and expression of human handedness.
21708131 CTNNA1 and CTNNA2 contain alternative 5' exons linked to bidirectional promoters that are shared with the antisense oriented LRRTM2 and LRRTM1 genes, respectively.
21041608 16 SNPs in 12 genes showed significant interaction at P < .05, 3 of which survived correction for multiple testing (P < .0003), situated in AKT1 (rs2494732 and rs1130233) and LRRTM1 (rs673871).
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20678249 Observational study of gene-disease association. (HuGE Navigator)
19626025 Results strengthen the evidence for an association of imprinted alleles of LRRTM1 with schizophrenia. Weaker supportive evidence was also obtained for a possible association of LRTTM1 with human brain asymmetry.
19125367 Recent study in which the first putative genetic effect on human handedness was identified (the imprinted locus LRRTM1 on human chromosome 2).
19125366 While we agree (and indeed first proposed) that the variation underlying psychosis is intrinsically related to the cerebral torque, which we take to be the anatomical basis of language, we are unconvinced by the data for LRRTM1.
19125365 Whether or not LRRTM1 on chromosome 2p12 is indeed the genetic basis of handedness is still unclear, although the controversy of the claim seems indisputable.
More...

AA Sequence

MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEAPHNLSGLLGL      1 - 70
SLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITQLPNTTFRPMPNLR     71 - 140
SVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRIFQDCRSLKFLDIGYNQLKSLARNSFAGLFK    141 - 210
LTELHLEHNDLVKVNFAHFPRLISLHSLCLRRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVP    211 - 280
HLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQG    281 - 350
EDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE    351 - 420
NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYV    421 - 490
DYKPNHIEGALVIINEYGSCTCHQQPARECEV                                          491 - 522
//

Text Mined References (16)

PMID Year Title
25111784 2014 Hypomethylation of the paternally inherited LRRTM1 promoter linked to schizophrenia.
24785688 2014 The imprinted gene LRRTM1 mediates schizotypy and handedness in a nonclinical population.
21708131 2011 Bidirectional transcription from human LRRTM2/CTNNA1 and LRRTM1/CTNNA2 gene loci leads to expression of N-terminally truncated CTNNA1 and CTNNA2 isoforms.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20678249 2010 Polymorphisms in leucine-rich repeat genes are associated with autism spectrum disorder susceptibility in populations of European ancestry.
19626025 2009 Supporting evidence for LRRTM1 imprinting effects in schizophrenia.
19125367 2009 Understanding the genetics of behavioural and psychiatric traits will only be achieved through a realistic assessment of their complexity.
19125366 2009 Where and what is the right shift factor or cerebral dominance gene? A critique of Francks et al. (2007).
19125365 2009 Editorial commentary: is LRRTM1 the gene for handedness?
17667961 2007 LRRTM1 on chromosome 2p12 is a maternally suppressed gene that is associated paternally with handedness and schizophrenia.
More...