Property Summary

NCBI Gene PubMed Count 177
Grant Count 56
R01 Count 44
Funding $7,259,193.34
PubMed Score 379.15
PubTator Score 240.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.525 0.015
esophageal adenocarcinoma 1.300 0.026
psoriasis 1.700 0.000
osteosarcoma 2.897 0.000
glioblastoma 1.200 0.012
medulloblastoma, large-cell 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.178 0.019
intraductal papillary-mucinous adenoma (... 1.400 0.018
Breast cancer 3.400 0.030
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma 1.100 0.023
primary Sjogren syndrome 1.200 0.010
ulcerative colitis 1.300 0.000
ovarian cancer 2.800 0.000
Down syndrome 1.200 0.001
dermatomyositis 1.100 0.018

Gene RIF (178)

PMID Text
26884832 MiR-30a-5p may play an essential role in the cell growth and apoptosis of hepatocellular carcinoma cells, partially via targeting AEG-1.
26823698 Suggest that miR-377 plays an important role in the development of NSCLC by regulating AEG-1 expression.
26710214 High AEG-1 staining index might be associated with tumor progression and poor survival status in patients with gastrointestinal cancer. Meta-analysis.
26683226 High MTDH expression is associated with multiple myeloma.
26418251 Data showed that AEG1 and MMP7 levels were both significantly increased and strongly correlated in non-small cell lung cancer (NSCLC) tissues. AEG-1 promotes NSCLC cell invasiveness through MAPK-p42/p44-dependent activation of MMP7.
26362536 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
26351209 Identify two novel factors, AKR1C2 (positive factor) and NF1 (negative factor), as the AEG-1 downstream players in the process of metastasis in liver cancer.
26336827 Results indicate that microRNA miR-497 directly inhibited the 3'-untranslated regions (3' UTRs) of vascular endothelial growth factor A (VEGFA) and astrocyte elevated gene-1 (AEG-1).
26318406 We identified two powerful genes in the liver cancer metastasis process, AEG-1 and AKR1C2.
26287185 Knockdown of MTDH inhibits phosphorylation of AKT and increased apoptosis related protein expression.
More...

AA Sequence

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG      1 - 70
WAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA     71 - 140
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV    141 - 210
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT    211 - 280
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG    281 - 350
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP    351 - 420
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL    421 - 490
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT    491 - 560
KSETSWESPKQIKKKKKARRET                                                    561 - 582
//

Text Mined References (187)

PMID Year Title
26884832 2015 MiR-30a-5p suppresses cell growth and enhances apoptosis of hepatocellular carcinoma cells via targeting AEG-1.
26823698 2015 MicroRNA-377 inhibits non-small-cell lung cancer through targeting AEG-1.
26710214 2015 Astrocyte Elevated Gene-1 as a Novel Clinicopathological and Prognostic Biomarker for Gastrointestinal Cancers: A Meta-Analysis with 2999 Patients.
26683226 2016 MTDH is an oncogene in multiple myeloma, which is suppressed by Bortezomib treatment.
26418251 2015 Astrocyte elevated gene-1 increases invasiveness of NSCLC through up-regulating MMP7.
26351209 2014 AEG-1 Promotes Metastasis Through Downstream AKR1C2 and NF1 in Liver Cancer.
26336827 2015 MiR-497 suppresses angiogenesis and metastasis of hepatocellular carcinoma by inhibiting VEGFA and AEG-1.
26318406 2016 High-Content Functional Screening of AEG-1 and AKR1C2 for the Promotion of Metastasis in Liver Cancer.
26287185 2015 Lentiviral-Mediated Short Hairpin RNA Knockdown of MTDH Inhibits Cell Growth and Induces Apoptosis by Regulating the PTEN/AKT Pathway in Hepatocellular Carcinoma.
26236947 2015 AMPK inhibits MTDH expression via GSK3? and SIRT1 activation: potential role in triple negative breast cancer cell proliferation.
More...