Property Summary

NCBI Gene PubMed Count 177
PubMed Score 379.15
PubTator Score 240.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ulcerative colitis 2087 2.10102850291781E-7
osteosarcoma 7933 1.83479509551792E-5
ovarian cancer 8492 2.41451730943643E-5
psoriasis 6685 3.92090504193977E-5
pediatric high grade glioma 2712 1.029593678444E-4
medulloblastoma, large-cell 6234 1.30176575239517E-4
Down syndrome 548 0.00130627927582771
primary Sjogren syndrome 789 0.0100646200561547
glioblastoma 5572 0.0117589242715318
Multiple myeloma 1328 0.0145116271082364
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0178381369241577
dermatomyositis 967 0.0184881763411328
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0190222173234904
group 3 medulloblastoma 2254 0.0230299119903315
esophageal adenocarcinoma 737 0.0257990234686446
Breast cancer 3099 0.0295618894879387
Disease Target Count Z-score Confidence
Cancer 2346 4.547 2.3

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.525 0.015
esophageal adenocarcinoma 1.300 0.026
psoriasis 1.700 0.000
osteosarcoma 2.897 0.000
glioblastoma 1.200 0.012
medulloblastoma, large-cell 1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.178 0.019
intraductal papillary-mucinous adenoma (... 1.400 0.018
Breast cancer 3.400 0.030
pediatric high grade glioma 1.200 0.000
group 3 medulloblastoma 1.100 0.023
primary Sjogren syndrome 1.200 0.010
ulcerative colitis 1.300 0.000
ovarian cancer 2.800 0.000
Down syndrome 1.200 0.001
dermatomyositis 1.100 0.018

Synonym

Accession Q86UE4 Q05DH2 Q52QU9 Q6PK07 Q8TCX3
Symbols 3D3
AEG1
AEG-1
LYRIC
LYRIC/3D3

Gene

PDB

4QMG  

  Ortholog (9)

Gene RIF (174)

PMID Text
26884832 MiR-30a-5p may play an essential role in the cell growth and apoptosis of hepatocellular carcinoma cells, partially via targeting AEG-1.
26823698 Suggest that miR-377 plays an important role in the development of NSCLC by regulating AEG-1 expression.
26710214 High AEG-1 staining index might be associated with tumor progression and poor survival status in patients with gastrointestinal cancer. Meta-analysis.
26683226 High MTDH expression is associated with multiple myeloma.
26418251 Data showed that AEG1 and MMP7 levels were both significantly increased and strongly correlated in non-small cell lung cancer (NSCLC) tissues. AEG-1 promotes NSCLC cell invasiveness through MAPK-p42/p44-dependent activation of MMP7.
26362536 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
26351209 Identify two novel factors, AKR1C2 (positive factor) and NF1 (negative factor), as the AEG-1 downstream players in the process of metastasis in liver cancer.
26336827 Results indicate that microRNA miR-497 directly inhibited the 3'-untranslated regions (3' UTRs) of vascular endothelial growth factor A (VEGFA) and astrocyte elevated gene-1 (AEG-1).
26318406 We identified two powerful genes in the liver cancer metastasis process, AEG-1 and AKR1C2.
26287185 Knockdown of MTDH inhibits phosphorylation of AKT and increased apoptosis related protein expression.
More...

AA Sequence

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG      1 - 70
WAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA     71 - 140
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV    141 - 210
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT    211 - 280
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG    281 - 350
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP    351 - 420
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL    421 - 490
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT    491 - 560
KSETSWESPKQIKKKKKARRET                                                    561 - 582
//

Text Mined References (187)

PMID Year Title
26884832 2015 MiR-30a-5p suppresses cell growth and enhances apoptosis of hepatocellular carcinoma cells via targeting AEG-1.
26823698 2015 MicroRNA-377 inhibits non-small-cell lung cancer through targeting AEG-1.
26710214 2015 Astrocyte Elevated Gene-1 as a Novel Clinicopathological and Prognostic Biomarker for Gastrointestinal Cancers: A Meta-Analysis with 2999 Patients.
26683226 2016 MTDH is an oncogene in multiple myeloma, which is suppressed by Bortezomib treatment.
26418251 2015 Astrocyte elevated gene-1 increases invasiveness of NSCLC through up-regulating MMP7.
26351209 2014 AEG-1 Promotes Metastasis Through Downstream AKR1C2 and NF1 in Liver Cancer.
26336827 2015 MiR-497 suppresses angiogenesis and metastasis of hepatocellular carcinoma by inhibiting VEGFA and AEG-1.
26318406 2016 High-Content Functional Screening of AEG-1 and AKR1C2 for the Promotion of Metastasis in Liver Cancer.
26287185 2015 Lentiviral-Mediated Short Hairpin RNA Knockdown of MTDH Inhibits Cell Growth and Induces Apoptosis by Regulating the PTEN/AKT Pathway in Hepatocellular Carcinoma.
26236947 2015 AMPK inhibits MTDH expression via GSK3? and SIRT1 activation: potential role in triple negative breast cancer cell proliferation.
More...