Property Summary

NCBI Gene PubMed Count 196
PubMed Score 417.27
PubTator Score 240.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 6.9e-05
Breast cancer 3.400 3.0e-02
dermatomyositis 1.100 1.8e-02
Down syndrome 1.200 1.3e-03
esophageal adenocarcinoma 1.300 2.6e-02
glioblastoma 1.200 1.2e-02
group 3 medulloblastoma 1.100 2.3e-02
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
medulloblastoma, large-cell 1.300 1.3e-04
Multiple myeloma 1.525 1.5e-02
osteosarcoma 1.948 5.2e-05
ovarian cancer -1.200 7.6e-03
pancreatic ductal adenocarcinoma liver m... -1.178 1.9e-02
primary Sjogren syndrome 1.200 1.0e-02
psoriasis 1.700 3.9e-05
ulcerative colitis 1.300 2.1e-07

Protein-protein Interaction (2)

Gene RIF (193)

AA Sequence

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG      1 - 70
WAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA     71 - 140
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV    141 - 210
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT    211 - 280
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG    281 - 350
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP    351 - 420
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL    421 - 490
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT    491 - 560
KSETSWESPKQIKKKKKARRET                                                    561 - 582
//

Text Mined References (206)

PMID Year Title