Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
R01 Count 1
Funding $983,084
PubMed Score 16.35
PubTator Score 12.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
uncontrolled asthma 2.200 0.003
osteosarcoma 2.228 0.049
group 3 medulloblastoma -1.600 0.000
glioblastoma -1.200 0.000
active ulcerative colitis 1.227 0.027
pancreatic cancer 1.400 0.000
adult high grade glioma -1.100 0.000
posterior fossa group A ependymoma -1.100 0.000
lung carcinoma 2.200 0.000

Gene RIF (7)

PMID Text
22948142 the ubiquitous tissue distribution of NHA2 suggests that H(+)-coupled transport is more widespread. The coexistence of Na(+) and H(+)-driven chemiosmotic circuits has implications for salt and pH regulation in the kidney.
20713131 mutation in AA residues V161 and F357 reduced ability of transfected BW31a cells to remove intracellular Na and grow in NaCl-medium; yeast expressing F357 F437 cannot grow in 0.4M NaCl, suggesting these residues also essential for antiporter activity
20332099 Observational study of gene-disease association. (HuGE Navigator)
20053353 cluster of essential, highly conserved titratable residues located in an assembly region made of two discontinuous helices of inverted topology, each interrupted by an extended chain
18508966 restricted to the distal convoluted tubule in the kidney
18000046 Na+/H+ antiporter genes may contribute to sodium-lithium countertransport activity and salt homeostasis in humans[NHA1 and NHA2]
17988971 NHA-oc/NHA2 displays the expected activities of a bona fide cation-proton antiporter and plays a key role(s) in normal osteoclast differentiation and function

AA Sequence

MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQ      1 - 70
RLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTL     71 - 140
PPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMG    141 - 210
PCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDI    211 - 280
LAITGFNTCLGIAFSTGSTVFNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLA    281 - 350
VFSSVHFGFPGSGGLCTLVMAFLAGMGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGL    351 - 420
CVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDV    421 - 490
LTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNKDEEVQGETSVQV                           491 - 537
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22948142 2012 Unconventional chemiosmotic coupling of NHA2, a mammalian Na+/H+ antiporter, to a plasma membrane H+ gradient.
20713131 2010 Mutational analysis of NHAoc/NHA2 in Saccharomyces cerevisiae.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20053353 2010 Model-guided mutagenesis drives functional studies of human NHA2, implicated in hypertension.
18600791 2008 Proteomic profile of osteoclast membrane proteins: identification of Na+/H+ exchanger domain containing 2 and its role in osteoclast fusion.
18508966 2008 Characterization of the sodium/hydrogen exchanger NHA2.
18000046 2007 A human Na+/H+ antiporter sharing evolutionary origins with bacterial NhaA may be a candidate gene for essential hypertension.
17988971 2008 NHA-oc/NHA2: a mitochondrial cation-proton antiporter selectively expressed in osteoclasts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...